Property Summary

NCBI Gene PubMed Count 48
Grant Count 59
R01 Count 18
Funding $8,730,883.77
PubMed Score 346.86
PubTator Score 101.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
malignant mesothelioma 1.800 0.000
glioblastoma 2.500 0.000
osteosarcoma 1.287 0.043
ependymoma 1.300 0.001
group 4 medulloblastoma -3.600 0.000
astrocytoma 1.500 0.009
atypical teratoid / rhabdoid tumor -3.200 0.000
medulloblastoma, large-cell -3.400 0.000
primitive neuroectodermal tumor 2.300 0.000
pancreatic ductal adenocarcinoma liver m... -3.692 0.000
interstitial cystitis -1.600 0.007
pediatric high grade glioma 2.500 0.000
pilocytic astrocytoma 1.800 0.000
pituitary cancer -2.900 0.000
Down syndrome 1.700 0.001
psoriasis 1.100 0.000

Synonym

Accession Q9NSC2 Q99881 Q9NSC3 Q9P1R0
Symbols TBS
HSAL1
Sal-1
ZNF794
HEL-S-89

Gene

Gene RIF (23)

PMID Text
24292671 Inhibition of SALL1 correlates with reduced levels of CDH1, an important contributor to epithelial-to-mesenchymal transition.
23069192 quantity and quality of SALL1 transcript are important for SALL1 function and determine phenotype, and mode of inheritance, of allelic SALL1-related disorders
22308078 report on a family with features of TBS in whom a novel 149 kb deletion spanning the SALL1 gene was identified by high resolution cytogenetics SNP microarray
21062744 novel role for Sall1 as a member of the transcriptional network that regulates stem cell pluripotency
20634891 Observational study of gene-disease association. (HuGE Navigator)
19942929 Sall1 induces angiogenesis by stimulating VEGF-A promoter activity.
19440552 Data demonstrate that stem cell protein SALL4 represses its target genes, PTEN and SALL1, through the epigenetic repressor Mi-2/NuRD complex.
19247946 Studies indicate that vertebrate sal orthologues (spalt-like/sall) have important developmental roles during neural development and organogenesis and gentic diseases.
19213029 Familial transmission of Goldenhar syndrome is not due to mutations in SALL1.
19005989 This case increases the demand to examine all children with Townes-Brocks Syndrome (TBS) for ophthalmic abnormalities.
More...

AA Sequence

MSRRKQAKPQHFQSDPEVASLPRRDGDTEKGQPSRPTKSKDAHVCGRCCAEFFELSDLLLHKKNCTKNQL      1 - 70
VLIVNENPASPPETFSPSPPPDNPDEQMNDTVNKTDQVDCSDLSEHNGLDREESMEVEAPVANKSGSGTS     71 - 140
SGSHSSTAPSSSSSSSSSSGGGGSSSTGTSAITTSLPQLGDLTTLGNFSVINSNVIIENLQSTKVAVAQF    141 - 210
SQEARCGGASGGKLAVPALMEQLLALQQQQIHQLQLIEQIRHQILLLASQNADLPTSSSPSQGTLRTSAN    211 - 280
PLSTLSSHLSQQLAAAAGLAQSLASQSASISGVKQLPPIQLPQSSSGNTIIPSNSGSSPNMNILAAAVTT    281 - 350
PSSEKVASSAGASHVSNPAVSSSSSPAFAISSLLSPASNPLLPQQASANSVFPSPLPNIGTTAEDLNSLS    351 - 420
ALAQQRKSKPPNVTAFEAKSTSDEAFFKHKCRFCAKVFGSDSALQIHLRSHTGERPFKCNICGNRFSTKG    421 - 490
NLKVHFQRHKEKYPHIQMNPYPVPEHLDNIPTSTGIPYGMSIPPEKPVTSWLDTKPVLPTLTTSVGLPLP    491 - 560
PTLPSLIPFIKTEEPAPIPISHSATSPPGSVKSDSGGPESATRNLGGLPEEAEGSTLPPSGGKSEESGMV    561 - 630
TNSVPTASSSVLSSPAADCGPAGSATTFTNPLLPLMSEQFKAKFPFGGLLDSAQASETSKLQQLVENIDK    631 - 700
KATDPNECIICHRVLSCQSALKMHYRTHTGERPFKCKICGRAFTTKGNLKTHYSVHRAMPPLRVQHSCPI    701 - 770
CQKKFTNAVVLQQHIRMHMGGQIPNTPVPDSYSESMESDTGSFDEKNFDDLDNFSDENMEDCPEGSIPDT    771 - 840
PKSADASQDSLSSSPLPLEMSSIAALENQMKMINAGLAEQLQASLKSVENGSIEGDVLTNDSSSVGGDME    841 - 910
SQSAGSPAISESTSSMQALSPSNSTQEFHKSPSIEEKPQRAVPSEFANGLSPTPVNGGALDLTSSHAEKI    911 - 980
IKEDSLGILFPFRDRGKFKNTACDICGKTFACQSALDIHYRSHTKERPFICTVCNRGFSTKGNLKQHMLT    981 - 1050
HQMRDLPSQLFEPSSNLGPNQNSAVIPANSLSSLIKTEVNGFVHVSPQDSKDTPTSHVPSGPLSSSATSP   1051 - 1120
VLLPALPRRTPKQHYCNTCGKTFSSSSALQIHERTHTGEKPFACTICGRAFTTKGNLKVHMGTHMWNSTP   1121 - 1190
ARRGRRLSVDGPMTFLGGNPVKFPEMFQKDLAARSGSGDPSSFWNQYAAALSNGLAMKANEISVIQNGGI   1191 - 1260
PPIPGSLGSGNSSPVSGLTGNLERLQNSEPNAPLAGLEKMASSENGTNFRFTRFVEDSKEIVTS         1261 - 1324
//

Text Mined References (52)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25241763 2014 Meta-analysis of genome-wide association studies identifies novel loci that influence cupping and the glaucomatous process.
24292671 2014 An in vivo RNAi screen identifies SALL1 as a tumor suppressor in human breast cancer with a role in CDH1 regulation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24165912 2013 Genome-wide association study identifies 8 novel loci associated with blood pressure responses to interventions in Han Chinese.
23643386 2013 Weight loss after gastric bypass is associated with a variant at 15q26.1.
23069192 2013 Homozygous SALL1 mutation causes a novel multiple congenital anomaly-mental retardation syndrome.
22504420 2012 Genome-wide meta-analysis identifies 56 bone mineral density loci and reveals 14 loci associated with risk of fracture.
22308078 2012 Implications for genotype-phenotype predictions in Townes-Brocks syndrome: case report of a novel SALL1 deletion and review of the literature.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...