Property Summary

NCBI Gene PubMed Count 89
PubMed Score 6.40
PubTator Score 98.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.100 0.000
cutaneous lupus erythematosus -1.900 0.001
osteosarcoma 1.013 0.000
non primary Sjogren syndrome sicca 1.100 0.032
subependymal giant cell astrocytoma -1.304 0.012
lung adenocarcinoma -1.300 0.000

Synonym

Accession Q9NSA3 Q5T4V2
Symbols ICAT

Gene

PDB

1T08   1LUJ   1M1E  

Gene RIF (75)

PMID Text
26317904 Data show that microRNA miR-215 activates beta-catenin pathways by decreasing catenin beta interacting protein 1 (CTNNBIP1)expression in gliomas.
26299367 CTNNBIP1 expression correlated with longer overall survival in LAC patients. This study reveals that miR-214 plays a critical role in CSLC self-renewal and stemness by targeting CTNNBIP1.
26284974 Finally, pro-incubation with idebenone inhibited mitochondrial dysfunction induced by oxLDL through the mitochondrial-dependent apoptotic pathway and GSK3beta/beta-catenin signalling pathways.
26124339 Nuclear YAP and cytoplasmic beta-catenin play important roles in carcinogenesis.
26124325 A statistically significant lapatinib- and gefitinib-induced repression of cyclin D1, MMP9 and beta-catenin in CERV196 cells.
26047787 Particulate matter (PM10) downregulates E-Cadherin/beta-Catenin expression.
25849888 These results indicate that beta-catenin translation is initiated via the IRES and this is regulated by PTX, suggesting that regulation of the IRES-dependent translation of beta-catenin may be involved in the cancer cell response to PTX treatment.
25845340 Simultaneous silencing of beta-catenin and STAT3 synergistically induces apoptosis and inhibits cell proliferation in HepG2 liver cancer cells.
25681036 miR-603 regulates glioma development via Wnt-beta-cateninn signaling pathway and its WIF1 and CTNNBIP1 targets.
25445594 Our results indicate that HDAC1 plays an important role in chondrogenesis and may represent a therapeutic target for modulation of cartilage development.
More...

AA Sequence

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA      1 - 70
FSRSETEDRRQ                                                                71 - 81
//

Text Mined References (91)

PMID Year Title
26317904 2015 MiR-215, an activator of the CTNNBIP1/?-catenin pathway, is a marker of poor prognosis in human glioma.
26299367 2015 Targeting the Wnt-Regulatory Protein CTNNBIP1 by microRNA-214 Enhances the Stemness and Self-Renewal of Cancer Stem-Like Cells in Lung Adenocarcinomas.
26284974 2015 Idebenone protects against oxidized low density lipoprotein induced mitochondrial dysfunction in vascular endothelial cells via GSK3?/?-catenin signalling pathways.
26124339 2015 Altered Expression of Yes-associated Protein and ?-Catenin in Non-neoplastic and Neoplastic Gastric Surface Epithelia.
26124325 2015 MMP9, Cyclin D1 and ?-Catenin Are Useful Markers of p16-positive Squamous Cell Carcinoma in Therapeutic EGFR Inhibition In Vitro.
26047787 2015 Particulate matter (PM??) induces metalloprotease activity and invasion in airway epithelial cells.
25849888 2015 ?-Catenin expression is regulated by an IRES-dependent mechanism and stimulated by paclitaxel in human ovarian cancer cells.
25845340 2015 Simultaneous silencing of ?-catenin and signal transducer and activator of transcription 3 synergistically induces apoptosis and inhibits cell proliferation in HepG2 liver cancer cells.
25681036 2015 miR-603 promotes glioma cell growth via Wnt/?-catenin pathway by inhibiting WIF1 and CTNNBIP1.
25445594 2014 Histone deacetylase1 promotes TGF-?1-mediated early chondrogenesis through down-regulating canonical Wnt signaling.
More...