Property Summary

NCBI Gene PubMed Count 89
PubMed Score 6.40
PubTator Score 98.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
lung adenocarcinoma 2714 5.75974333730948E-8
psoriasis 6685 1.06000320627858E-6
osteosarcoma 7933 2.63836651961256E-5
cutaneous lupus erythematosus 1056 7.86249737948698E-4
subependymal giant cell astrocytoma 2287 0.0115226090395844
non primary Sjogren syndrome sicca 840 0.0321350149696081
Disease Target Count Z-score Confidence
Schnyder Corneal Dystrophy 24 3.541 1.8

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.100 0.000
cutaneous lupus erythematosus -1.900 0.001
osteosarcoma 1.013 0.000
non primary Sjogren syndrome sicca 1.100 0.032
subependymal giant cell astrocytoma -1.304 0.012
lung adenocarcinoma -1.300 0.000

Synonym

Accession Q9NSA3 Q5T4V2
Symbols ICAT

Gene

PDB

1T08   1LUJ   1M1E  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (75)

PMID Text
26317904 Data show that microRNA miR-215 activates beta-catenin pathways by decreasing catenin beta interacting protein 1 (CTNNBIP1)expression in gliomas.
26299367 CTNNBIP1 expression correlated with longer overall survival in LAC patients. This study reveals that miR-214 plays a critical role in CSLC self-renewal and stemness by targeting CTNNBIP1.
26284974 Finally, pro-incubation with idebenone inhibited mitochondrial dysfunction induced by oxLDL through the mitochondrial-dependent apoptotic pathway and GSK3beta/beta-catenin signalling pathways.
26124339 Nuclear YAP and cytoplasmic beta-catenin play important roles in carcinogenesis.
26124325 A statistically significant lapatinib- and gefitinib-induced repression of cyclin D1, MMP9 and beta-catenin in CERV196 cells.
26047787 Particulate matter (PM10) downregulates E-Cadherin/beta-Catenin expression.
25849888 These results indicate that beta-catenin translation is initiated via the IRES and this is regulated by PTX, suggesting that regulation of the IRES-dependent translation of beta-catenin may be involved in the cancer cell response to PTX treatment.
25845340 Simultaneous silencing of beta-catenin and STAT3 synergistically induces apoptosis and inhibits cell proliferation in HepG2 liver cancer cells.
25681036 miR-603 regulates glioma development via Wnt-beta-cateninn signaling pathway and its WIF1 and CTNNBIP1 targets.
25445594 Our results indicate that HDAC1 plays an important role in chondrogenesis and may represent a therapeutic target for modulation of cartilage development.
More...

AA Sequence

MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMA      1 - 70
FSRSETEDRRQ                                                                71 - 81
//

Text Mined References (91)

PMID Year Title
26317904 2015 MiR-215, an activator of the CTNNBIP1/?-catenin pathway, is a marker of poor prognosis in human glioma.
26299367 2015 Targeting the Wnt-Regulatory Protein CTNNBIP1 by microRNA-214 Enhances the Stemness and Self-Renewal of Cancer Stem-Like Cells in Lung Adenocarcinomas.
26284974 2015 Idebenone protects against oxidized low density lipoprotein induced mitochondrial dysfunction in vascular endothelial cells via GSK3?/?-catenin signalling pathways.
26124339 2015 Altered Expression of Yes-associated Protein and ?-Catenin in Non-neoplastic and Neoplastic Gastric Surface Epithelia.
26124325 2015 MMP9, Cyclin D1 and ?-Catenin Are Useful Markers of p16-positive Squamous Cell Carcinoma in Therapeutic EGFR Inhibition In Vitro.
26047787 2015 Particulate matter (PM??) induces metalloprotease activity and invasion in airway epithelial cells.
25849888 2015 ?-Catenin expression is regulated by an IRES-dependent mechanism and stimulated by paclitaxel in human ovarian cancer cells.
25845340 2015 Simultaneous silencing of ?-catenin and signal transducer and activator of transcription 3 synergistically induces apoptosis and inhibits cell proliferation in HepG2 liver cancer cells.
25681036 2015 miR-603 promotes glioma cell growth via Wnt/?-catenin pathway by inhibiting WIF1 and CTNNBIP1.
25445594 2014 Histone deacetylase1 promotes TGF-?1-mediated early chondrogenesis through down-regulating canonical Wnt signaling.
More...