Property Summary

NCBI Gene PubMed Count 16
PubMed Score 13.36
PubTator Score 14.65

Knowledge Summary

Patent (296)

TINX Plot

  Disease Relevance (3)

Expression

Gene RIF (3)

PMID Text
25003238 reflected in the immunoblotting data KV4.1 receptors were detected at higher levels of expression in patient with cortical dysplasia with intractable epilepsy.
24675763 S-glutathionylation of an auxiliary subunit confers redox sensitivity to Kv4 channel inactivation.
19401188 These results demonstrated that Kv4.1 plays a role in proliferation of tumorigenic human mammary epithelial cells.

AA Sequence

MAAGLATWLPFARAAAVGWLPLAQQPLPPAPGVKASRGDEVLVVNVSGRRFETWKNTLDRYPDTLLGSSE      1 - 70
KEFFYDADSGEYFFDRDPDMFRHVLNFYRTGRLHCPRQECIQAFDEELAFYGLVPELVGDCCLEEYRDRK     71 - 140
KENAERLAEDEEAEQAGDGPALPAGSSLRQRLWRAFENPHTSTAALVFYYVTGFFIAVSVIANVVETIPC    141 - 210
RGSARRSSREQPCGERFPQAFFCMDTACVLIFTGEYLLRLFAAPSRCRFLRSVMSLIDVVAILPYYIGLL    211 - 280
VPKNDDVSGAFVTLRVFRVFRIFKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKG    281 - 350
TNKTNFTSIPAAFWYTIVTMTTLGYGDMVPSTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQR    351 - 420
ADKRRAQQKVRLARIRLAKSGTTNAFLQYKQNGGLEDSGSGEEQALCVRNRSAFEQQHHHLLHCLEKTTC    421 - 490
HEFTDELTFSEALGAVSPGGRTSRSTSVSSQPVGPGSLLSSCCPRRAKRRAIRLANSTASVSRGSMQELD    491 - 560
MLAGLRRSHAPQSRSSLNAKPHDSLDLNCDSRDFVAAIISIPTPPANTPDESQPSSPGGGGRAGSTLRNS    561 - 630
SLGTPCLFPETVKISSL                                                         631 - 647
//

Text Mined References (17)

PMID Year Title
25003238 2014 Expression of astrocyte-related receptors in cortical dysplasia with intractable epilepsy.
24675763 2014 S-glutathionylation of an auxiliary subunit confers redox sensitivity to Kv4 channel inactivation.
20930388 2010 Involvement of Kv4.1 K(+) channels in gastric cancer cell proliferation.
19448731 2009 Volume regulation in the human airway epithelial cell line Calu-3.
19401188 2009 Silencing of Kv4.1 potassium channels inhibits cell proliferation of tumorigenic human mammary epithelial cells.
17687001 2007 Electrophysiological properties of human adipose tissue-derived stem cells.
16382104 2005 International Union of Pharmacology. LIII. Nomenclature and molecular relationships of voltage-gated potassium channels.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15454437 2004 Modulation of Kv4.2 channel expression and gating by dipeptidyl peptidase 10 (DPP10).
More...