Property Summary

NCBI Gene PubMed Count 205
PubMed Score 777.38
PubTator Score 387.95

Knowledge Summary

Patent

No data available

Expression

Gene RIF (194)

AA Sequence

MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVG      1 - 70
GAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAH     71 - 140
GLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS     141 - 209
//

Text Mined References (207)

PMID Year Title