Property Summary

NCBI Gene PubMed Count 165
Grant Count 57
R01 Count 31
Funding $6,886,322.78
PubMed Score 641.66
PubTator Score 387.95

Knowledge Summary

Patent

No data available

Gene RIF (154)

PMID Text
26962859 Human FGF-21 Is a Substrate of Fibroblast Activation Protein.
26867126 GDF-15 and FGF-21 are elevated in mitochondrial diseases
26823820 FGF-21 might involve in the development and maintenance of atrial fibrosis in atrial fibrillation with rheumatic heart disease, and FGF-21 could be used as a novel biomarker to evaluate myocardial fibrosis in the future.
26797127 This study identified fibroblast activation protein (FAP) as the enzyme that cleaves and inactivates human FGF21.
26567701 discusses current knowledge of the complex biology of the endocrine FGFs.
26529252 These data establish FGF21 as a fasting-induced hormone in humans and indicate that FGF21 contributes to the late stages of adaptive starvation, when it may regulate the utilization of fuel derived from tissue breakdown.
26456333 the hepatokine IGFBP1 is a critical liver-bone hormonal relay that promotes osteoclastogenesis and bone resorption as well as an essential mediator of FGF21-induced bone loss
26338887 Data suggest expression of FGF21 in liver can be regulated by dietary factors; curcumin (antioxidant dietary supplement) up-regulates FGF21 in human hepatocytes (HepG2 cells) and in mouse liver (to prevent prediabetic state induced by dexamethasone).
26329882 Appropriate signaling of FGF21 to neonate is necessary to ensure optimal digestive and endocrine function in developing intestine.
26294388 Data (including data from hamster studies using continuous subcutaneous infusion of recombinant FGF21) suggest FGF21 exerts metabolic effects in liver by modulating nutrient flux/energy metabolism via both carbohydrate metabolism and fat metabolism.
More...

AA Sequence

MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDAQQTEAHLEIREDGTVG      1 - 70
GAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSLHFDPEACSFRELLLEDGYNVYQSEAH     71 - 140
GLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPALPEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS     141 - 209
//

Text Mined References (167)

PMID Year Title
26962859 2016 Human FGF-21 Is a Substrate of Fibroblast Activation Protein.
26867126 2016 GDF-15 Is Elevated in Children with Mitochondrial Diseases and Is Induced by Mitochondrial Dysfunction.
26823820 2015 Fibroblast growth factor-21 is positively associated with atrial fibrosis in atrial fibrillation patients with rheumatic heart disease.
26797127 2016 Fibroblast Activation Protein Cleaves and Inactivates Fibroblast Growth Factor 21.
26567701 2016 Therapeutic potential of the endocrine fibroblast growth factors FGF19, FGF21 and FGF23.
26529252 2015 FGF21 and the late adaptive response to starvation in humans.
26456333 2015 A Liver-Bone Endocrine Relay by IGFBP1 Promotes Osteoclastogenesis and Mediates FGF21-Induced Bone Resorption.
26338887 2015 Short-Term Curcumin Gavage Sensitizes Insulin Signaling in Dexamethasone-Treated C57BL/6 Mice.
26329882 2015 Fibroblast growth factor 21 in breast milk controls neonatal intestine function.
26294388 2015 Dual effects of fibroblast growth factor 21 on hepatic energy metabolism.
More...