Property Summary

NCBI Gene PubMed Count 42
PubMed Score 48.90
PubTator Score 58.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
nephrosclerosis -1.231 0.024
medulloblastoma, large-cell 1.100 0.000
ovarian cancer 1.200 0.000

Synonym

Accession Q9NSA0 A8K426 Q53GR2 Q6ZP72 Q8NBU4
Symbols OAT4
hOAT4

Gene

Gene RIF (24)

PMID Text
26740304 The regulation of hOAT4 activity was mediated by sgk2 acting through Nedd4-2.
26303760 modifies placental passage of perfluorinated alkyl acids, may decrease fetal exposure
25919187 SLC22A11 at the basal plasma membrane of human placental syncytiotrophoblasts plays a predominant role in the uptake of 16alpha-OH DHEAS for placental estriol synthesis.
24360580 Our analysis provides evidence for multiple ancestral-specific effects across the SLC22A11/SLC22A12 locus that presumably influence the activity of OAT4 and URAT1 and risk of gout.
24025986 A common variant of OAT4/SLC22A11 is associated with renal underexcretion type gout in Japanese men.
22753387 When investigating the genes separately, SLC22A11 and SLC2A9 showed a significant interaction, consistent with the former encoding an organic anion/dicarboxylate exchanger, which mediates diuretic transport in the kidney.
20884846 Meta-analysis and genome-wide association study of gene-disease association. (HuGE Navigator)
20668102 Genetic variants of human organic anion transporter 4 demonstrate altered transport of endogenous substrates.
20668102 Observational study of genotype prevalence. (HuGE Navigator)
20140636 The down-regulation of hOAT4 activity by activation of protein kinase C and the up-regulation of hOAT4 activity by NHERF-1 are mediated through alteration of hOAT4 internalization.
More...

AA Sequence

MAFSKLLEQAGGVGLFQTLQVLTFILPCLMIPSQMLLENFSAAIPGHRCWTHMLDNGSAVSTNMTPKALL      1 - 70
TISIPPGPNQGPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSVFTSTIVAKWDLVCSSQG     71 - 140
LKPLSQSIFMSGILVGSFIWGLLSYRFGRKPMLSWCCLQLAVAGTSTIFAPTFVIYCGLRFVAAFGMAGI    141 - 210
FLSSLTLMVEWTTTSRRAVTMTVVGCAFSAGQAALGGLAFALRDWRTLQLAASVPFFAISLISWWLPESA    211 - 280
RWLIIKGKPDQALQELRKVARINGHKEAKNLTIEVLMSSVKEEVASAKEPRSVLDLFCVPVLRWRSCAML    281 - 350
VVNFSLLISYYGLVFDLQSLGRDIFLLQALFGAVDFLGRATTALLLSFLGRRTIQAGSQAMAGLAILANM    351 - 420
LVPQDLQTLRVVFAVLGKGCFGISLTCLTIYKAELFPTPVRMTADGILHTVGRLGAMMGPLILMSRQALP    421 - 490
LLPPLLYGVISIASSLVVLFFLPETQGLPLPDTIQDLESQKSTAAQGNRQEAVTVESTSL              491 - 550
//

Text Mined References (42)

PMID Year Title
26740304 2016 Serum- and glucocorticoid-inducible kinase SGK2 regulates human organic anion transporters 4 via ubiquitin ligase Nedd4-2.
26303760 2015 Organic anion transporter 4 (OAT 4) modifies placental transfer of perfluorinated alkyl acids PFOS and PFOA in human placental ex vivo perfusion system.
25919187 2015 Role of OAT4 in Uptake of Estriol Precursor 16?-Hydroxydehydroepiandrosterone Sulfate Into Human Placental Syncytiotrophoblasts From Fetus.
24360580 2013 Association analysis of the SLC22A11 (organic anion transporter 4) and SLC22A12 (urate transporter 1) urate transporter locus with gout in New Zealand case-control sample sets reveals multiple ancestral-specific effects.
24025986 2014 A common variant of organic anion transporter 4 (OAT4/SLC22A11) gene is associated with renal underexcretion type gout.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23263486 2013 Genome-wide association analyses identify 18 new loci associated with serum urate concentrations.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
22753387 2013 A urate gene-by-diuretic interaction and gout risk in participants with hypertension: results from the ARIC study.
20884846 2010 Multiple genetic loci influence serum urate levels and their relationship with gout and cardiovascular disease risk factors.
More...