Property Summary

NCBI Gene PubMed Count 15
PubMed Score 256.57
PubTator Score 99.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma -1.200 3.6e-03
Astrocytoma, Pilocytic -1.500 5.1e-05
Breast cancer -1.400 2.4e-04
breast carcinoma -1.600 1.7e-04
ductal carcinoma in situ -2.500 2.4e-04
Endometriosis -1.225 6.7e-03
ependymoma -1.200 2.4e-02
fibroadenoma -1.500 4.1e-02
glioblastoma -1.400 4.7e-06
group 3 medulloblastoma -1.600 9.9e-03
invasive ductal carcinoma -1.130 3.6e-02
lung adenocarcinoma -1.700 1.1e-16
lung cancer -1.900 8.1e-04
non primary Sjogren syndrome sicca 1.400 2.5e-02
non-small cell lung cancer -1.996 9.8e-17
osteosarcoma -3.770 8.9e-05
ovarian cancer 1.800 2.3e-10
primitive neuroectodermal tumor -1.200 1.2e-02
psoriasis -2.100 2.1e-09

Gene RIF (7)

AA Sequence

MAPSAWAICWLLGGLLLHGGSSGPSPGPSVPRLRLSYRDLLSANRSAIFLGPQGSLNLQAMYLDEYRDRL      1 - 70
FLGGLDALYSLRLDQAWPDPREVLWPPQPGQREECVRKGRDPLTECANFVRVLQPHNRTHLLACGTGAFQ     71 - 140
PTCALITVGHRGEHVLHLEPGSVESGRGRCPHEPSRPFASTFIDGELYTGLTADFLGREAMIFRSGGPRP    141 - 210
ALRSDSDQSLLHDPRFVMAARIPENSDQDNDKVYFFFSETVPSPDGGSNHVTVSRVGRVCVNDAGGQRVL    211 - 280
VNKWSTFLKARLVCSVPGPGGAETHFDQLEDVFLLWPKAGKSLEVYALFSTVSAVFQGFAVCVYHMADIW    281 - 350
EVFNGPFAHRDGPQHQWGPYGGKVPFPRPGVCPSKMTAQPGRPFGSTKDYPDEVLQFARAHPLMFWPVRP    351 - 420
RHGRPVLVKTHLAQQLHQIVVDRVEAEDGTYDVIFLGTDSGSVLKVIALQAGGSAEPEEVVLEELQVFKV    421 - 490
PTPITEMEISVKRQMLYVGSRLGVAQLRLHQCETYGTACAECCLARDPYCAWDGASCTHYRPSLGKRRFR    491 - 560
RQDIRHGNPALQCLGQSQEEEAVGLVAATMVYGTEHNSTFLECLPKSPQAAVRWLLQRPGDEGPDQVKTD    561 - 630
ERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLAS    631 - 700
TPPKAWYKDILQLIGFANLPRVDEYCERVWCRGTTECSGCFRSRSRGKQARGKSWAGLELGKKMKSRVHA    701 - 770
EHNRTPREVEAT                                                              771 - 782
//

Text Mined References (15)

PMID Year Title