Property Summary

NCBI Gene PubMed Count 15
Grant Count 3
Funding $612,916.83
PubMed Score 248.60
PubTator Score 99.91

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
ependymoma -1.500 0.000
psoriasis -2.100 0.000
osteosarcoma -3.770 0.000
glioblastoma -1.400 0.000
sonic hedgehog group medulloblastoma -1.800 0.000
primitive neuroectodermal tumor -1.200 0.012
non-small cell lung cancer -1.996 0.000
lung cancer -1.900 0.001
breast carcinoma -1.600 0.000
fibroadenoma -1.500 0.041
pediatric high grade glioma -1.300 0.000
pilocytic astrocytoma -1.400 0.000
non primary Sjogren syndrome sicca 1.400 0.025
lung adenocarcinoma -2.176 0.000
invasive ductal carcinoma -3.400 0.000
Endometriosis -1.225 0.007
Breast cancer -1.400 0.000
ductal carcinoma in situ -2.500 0.000
ovarian cancer 1.800 0.000

Gene RIF (7)

PMID Text
25335934 Results identify Sema3g as one of the downstream effectors of PPAR-gamma, which is centrally involved in regulating endothelial cell migration.
22562223 overexpressed SEMA3G inhibited the migratory and invasive behavior of U251MG cancer cells
20947821 Identify Sema3G as a primarily endothelial cell-expressed class 3 semaphorin that controls endothelial and smooth muscle cell functions in autocrine and paracrine manners.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18818766 Sema3G inhibits tumor progression from MDA-MB-435 but not from MDA-MB-231 cancer cells. It inhibits tumor angiogenesis in MDA-MB-231 cells.
18781179 In gliomas, SEMA3B, SEMA3G and NRP2 expressions were related to prolonged survival

AA Sequence

MAPSAWAICWLLGGLLLHGGSSGPSPGPSVPRLRLSYRDLLSANRSAIFLGPQGSLNLQAMYLDEYRDRL      1 - 70
FLGGLDALYSLRLDQAWPDPREVLWPPQPGQREECVRKGRDPLTECANFVRVLQPHNRTHLLACGTGAFQ     71 - 140
PTCALITVGHRGEHVLHLEPGSVESGRGRCPHEPSRPFASTFIDGELYTGLTADFLGREAMIFRSGGPRP    141 - 210
ALRSDSDQSLLHDPRFVMAARIPENSDQDNDKVYFFFSETVPSPDGGSNHVTVSRVGRVCVNDAGGQRVL    211 - 280
VNKWSTFLKARLVCSVPGPGGAETHFDQLEDVFLLWPKAGKSLEVYALFSTVSAVFQGFAVCVYHMADIW    281 - 350
EVFNGPFAHRDGPQHQWGPYGGKVPFPRPGVCPSKMTAQPGRPFGSTKDYPDEVLQFARAHPLMFWPVRP    351 - 420
RHGRPVLVKTHLAQQLHQIVVDRVEAEDGTYDVIFLGTDSGSVLKVIALQAGGSAEPEEVVLEELQVFKV    421 - 490
PTPITEMEISVKRQMLYVGSRLGVAQLRLHQCETYGTACAECCLARDPYCAWDGASCTHYRPSLGKRRFR    491 - 560
RQDIRHGNPALQCLGQSQEEEAVGLVAATMVYGTEHNSTFLECLPKSPQAAVRWLLQRPGDEGPDQVKTD    561 - 630
ERVLHTERGLLFRRLSRFDAGTYTCTTLEHGFSQTVVRLALVVIVASQLDNLFPPEPKPEEPPARGGLAS    631 - 700
TPPKAWYKDILQLIGFANLPRVDEYCERVWCRGTTECSGCFRSRSRGKQARGKSWAGLELGKKMKSRVHA    701 - 770
EHNRTPREVEAT                                                              771 - 782
//

Text Mined References (15)

PMID Year Title
25335934 2015 PPAR-? promotes endothelial cell migration by inducing the expression of Sema3g.
23974872 2013 Genome-wide association analysis identifies 13 new risk loci for schizophrenia.
22562223 2012 Effects of SEMA3G on migration and invasion of glioma cells.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
20947821 2011 Differential endothelial transcriptomics identifies semaphorin 3G as a vascular class 3 semaphorin.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19199708 2009 Proteomic analysis of human parotid gland exosomes by multidimensional protein identification technology (MudPIT).
18818766 2008 Successful inhibition of tumor development by specific class-3 semaphorins is associated with expression of appropriate semaphorin receptors by tumor cells.
18781179 2008 Semaphorin, neuropilin and VEGF expression in glial tumours: SEMA3G, a prognostic marker?
More...