Property Summary

NCBI Gene PubMed Count 70
Grant Count 76
R01 Count 56
Funding $4,595,872.91
PubMed Score 164.07
PubTator Score 162.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q9NS91 Q58F55 Q9NRT6
Symbols RNF73

Gene

PDB

2MRE   2YBF   2MRF   2Y43  

Gene RIF (56)

PMID Text
25961918 USP7-mediated de-ubiquitylation protects Rad18 from proteasomal degradation and is necessary for the integrity of the specialized translesion synthesis pathway
25913620 these results suggest that miR-145 can act as an RAD18 inhibitor and contribute as an important factor in reversing drug resistance after chemotherapy.
25756347 We obtained a molecular envelope for Rad18 UBZ-ELRM:linear Ub2 polyubiquitin chains by small-angle X-ray scattering and derived a structural model for the complex.
25675240 RAD18 can function as a mediator for DNA damage response signals to activate the G2/M checkpoint in order to maintain genome integrity and cell survival after IR exposure.
25417706 Significantly restored tolerance of RAD18-/- and RNF8-/- cells to camptothecin and olaparib without affecting Rad51 focus formation.
25162118 Rad18 protein ubiquitin-binding zinc fingers domain has alpha-helix and strand beta1 conformation.
25023518 Monoubiquitination has a role in controlling Rad18 function.
24672041 The Rad6/18 ubiquitin complex interacts with the Epstein-Barr virus deubiquitinating enzyme, BPLF1, and contributes to virus infectivity.
24518219 Findings indicate that RAD18 may serve as a key mediator of the ionizing radiation (IR)response and may function as a potential target for circumventing IR resistance in glioblastoma multiforme (GBM).
24036990 HHR6 and hRad18 can monoubiquitinate FANCD2 at lysine 561 in vitro. This activity may represent a novel stress response pathway.
More...

AA Sequence

MDSLAESRWPPGLAVMKTIDDLLRCGICFEYFNIAMIIPQCSHNYCSLCIRKFLSYKTQCPTCCVTVTEP      1 - 70
DLKNNRILDELVKSLNFARNHLLQFALESPAKSPASSSSKNLAVKVYTPVASRQSLKQGSRLMDNFLIRE     71 - 140
MSGSTSELLIKENKSKFSPQKEASPAAKTKETRSVEEIAPDPSEAKRPEPPSTSTLKQVTKVDCPVCGVN    141 - 210
IPESHINKHLDSCLSREEKKESLRSSVHKRKPLPKTVYNLLSDRDLKKKLKEHGLSIQGNKQQLIKRHQE    211 - 280
FVHMYNAQCDALHPKSAAEIVREIENIEKTRMRLEASKLNESVMVFTKDQTEKEIDEIHSKYRKKHKSEF    281 - 350
QLLVDQARKGYKKIAGMSQKTVTITKEDESTEKLSSVCMGQEDNMTSVTNHFSQSKLDSPEELEPDREED    351 - 420
SSSCIDIQEVLSSSESDSCNSSSSDIIRDLLEEEEAWEASHKNDLQDTEISPRQNRRTRAAESAEIEPRN    421 - 490
KRNRN                                                                     491 - 495
//

Text Mined References (84)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25961918 2016 USP7 is essential for maintaining Rad18 stability and DNA damage tolerance.
25931565 2015 DNA repair. Proteomics reveals dynamic assembly of repair complexes during bypass of DNA cross-links.
25913620 2015 Tumor suppressor miR-145 reverses drug resistance by directly targeting DNA damage-related gene RAD18 in colorectal cancer.
25756347 2015 Molecular determinants of polyubiquitin recognition by continuous ubiquitin-binding domains of Rad18.
25675240 2015 RAD18 activates the G2/M checkpoint through DNA damage signaling to maintain genome integrity after ionizing radiation exposure.
25417706 2015 Rad18 and Rnf8 facilitate homologous recombination by two distinct mechanisms, promoting Rad51 focus formation and suppressing the toxic effect of nonhomologous end joining.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25162118 2014 NMR structure of the human Rad18 zinc finger in complex with ubiquitin defines a class of UBZ domains in proteins linked to the DNA damage response.
More...