Property Summary

NCBI Gene PubMed Count 16
Grant Count 9
R01 Count 9
Funding $1,310,139.35
PubMed Score 25.31
PubTator Score 18.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
26969727 When intersecting microtubules are parallel, Kif15 motors can drive (biased) parallel sliding because the motor simultaneously steps on both microtubules that it cross-links.
25127142 Eg5, Kif15, and dynein work together to build a bipolar spindle and reveal an important role for antagonistic motors in chromosome segregation.
24668168 These data reveal that hKif15 is a plus-end-directed processive homotetramer that can step against loads of up to 3.5 pN.
24659801 regulates alpha2 integrin internalization
24419385 Although Kif15 contains ADP in the catalytic site, its motor-domain structure was captured in the ;ATP-like' configuration, with the neck linker docked to the catalytic core.
23791727 By examining Kif15 activity in two cellular contexts, it was found that Kif15 bound to kinetochore fibers antagonizes centrosome separation while Kif15 bound to nonkinetochore MTs mediates centrosome separation.
22024925 Pole separation depends on Hklp2/Kif15, an otherwise dispensable plus end-directed spindle motor and results in spindles with two centrosomal poles.
19818619 Hklp2 participates in the assembly and stabilization of the bipolar spindle.
19818618 Kif15 can replace all essential functions of Eg5 in bipolar spindle assembly.

AA Sequence

MAPGCKTELRSVTNGQSNQPSNEGDAIKVFVRIRPPAERSGSADGEQNLCLSVLSSTSLRLHSNPEPKTF      1 - 70
TFDHVADVDTTQESVFATVAKSIVESCMSGYNGTIFAYGQTGSGKTFTMMGPSESDNFSHNLRGVIPRSF     71 - 140
EYLFSLIDREKEKAGAGKSFLCKCSFIEIYNEQIYDLLDSASAGLYLREHIKKGVFVVGAVEQVVTSAAE    141 - 210
AYQVLSGGWRNRRVASTSMNRESSRSHAVFTITIESMEKSNEIVNIRTSLLNLVDLAGSERQKDTHAEGM    211 - 280
RLKEAGNINRSLSCLGQVITALVDVGNGKQRHVCYRDSKLTFLLRDSLGGNAKTAIIANVHPGSRCFGET    281 - 350
LSTLNFAQRAKLIKNKAVVNEDTQGNVSQLQAEVKRLKEQLAELASGQTPPESFLTRDKKKTNYMEYFQE    351 - 420
AMLFFKKSEQEKKSLIEKVTQLEDLTLKKEKFIQSNKMIVKFREDQIIRLEKLHKESRGGFLPEEQDRLL    421 - 490
SELRNEIQTLREQIEHHPRVAKYAMENHSLREENRRLRLLEPVKRAQEMDAQTIAKLEKAFSEISGMEKS    491 - 560
DKNQQGFSPKAQKEPCLFANTEKLKAQLLQIQTELNNSKQEYEEFKELTRKRQLELESELQSLQKANLNL    561 - 630
ENLLEATKACKRQEVSQLNKIHAETLKIITTPTKAYQLHSRPVPKLSPEMGSFGSLYTQNSSILDNDILN    631 - 700
EPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVDKLEHHSTQMQELFSSERIDWTK    701 - 770
QQEELLSQLNVLEKQLQETQTKNDFLKSEVHDLRVVLHSADKELSSVKLEYSSFKTNQEKEFNKLSERHM    771 - 840
HVQLQLDNLRLENEKLLESKACLQDSYDNLQEIMKFEIDQLSRNLQNFKKENETLKSDLNNLMELLEAEK    841 - 910
ERNNKLSLQFEEDKENSSKEILKVLEAVRQEKQKETAKCEQQMAKVQKLEESLLATEKVISSLEKSRDSD    911 - 980
KKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR    981 - 1050
ILSEDIERDMLCEDLAHATEQLNMLTEASKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNE   1051 - 1120
YNFKMRQLEHVMDSAAEDPQSPKTPPHFQTHLAKLLETQEQEIEDGRASKTSLEHLVTKLNEDREVKNAE   1121 - 1190
ILRMKEQLREMENLRLESQQLIEKNWLLQGQLDDIKRQKENSDQNHPDNQQLKNEQEESIKERLAKSKIV   1191 - 1260
EEMLKMKADLEEVQSALYNKEMECLRMTDEVERTQTLESKAFQEKEQLRSKLEEMYEERERTSQEMEMLR   1261 - 1330
KQVECLAEENGKLVGHQNLHQKIQYVVRLKKENVRLAEETEKLRAENVFLKEKKRSES               1331 - 1388
//

Text Mined References (24)

PMID Year Title
26969727 2016 Kinesin-12 motors cooperate to suppress microtubule catastrophes and drive the formation of parallel microtubule bundles.
25127142 2014 Balanced activity of three mitotic motors is required for bipolar spindle assembly and chromosome segregation.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24668168 2014 The Kinesin-12 Kif15 is a processive track-switching tetramer.
24659801 2014 An RNAi screen identifies KIF15 as a novel regulator of the endocytic trafficking of integrin.
24419385 2014 The crystal structure and biochemical characterization of Kif15: a bifunctional molecular motor involved in bipolar spindle formation and neuronal development.
23791727 2013 Kinesin-12 differentially affects spindle assembly depending on its microtubule substrate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22024925 2011 Modulated microtubule dynamics enable Hklp2/Kif15 to assemble bipolar spindles.
21269460 2011 Initial characterization of the human central proteome.
More...