Property Summary

NCBI Gene PubMed Count 16
PubMed Score 25.31
PubTator Score 18.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
non-small cell lung cancer 2798 5.90010682319515E-25
Breast cancer 3099 1.9706872521026E-18
atypical teratoid/rhabdoid tumor 1095 5.54657060627482E-11
group 3 medulloblastoma 2254 2.59259533481753E-9
glioblastoma 5572 9.13398355852207E-9
malignant mesothelioma 3163 9.40960778325243E-7
medulloblastoma, large-cell 6234 1.15427166248069E-6
primitive neuroectodermal tumor 3031 1.93309470496457E-6
oligodendroglioma 2849 2.20121943009847E-6
pediatric high grade glioma 2712 6.60400500602153E-6
Atopic dermatitis 944 9.44472305441261E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.41467536572589E-5
posterior fossa group A ependymoma 1511 3.87075852438632E-5
lung cancer 4473 6.41176858227724E-5
ovarian cancer 8492 6.52971725704117E-5
nasopharyngeal carcinoma 1056 6.8371101631462E-5
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00115170036376152
invasive ductal carcinoma 2950 0.00130381793493703
adrenocortical carcinoma 1427 0.00237011514022568
psoriasis 6685 0.00821497325286807
ductal carcinoma in situ 1745 0.00843273429555132
Endometriosis 535 0.0105169437026898
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0

Expression

Synonym

Accession Q9NS87 Q17RV9 Q69YL6 Q96JX7 Q9H280
Symbols HKLP2
KNSL7
NY-BR-62

Gene

PDB

4BN2  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (9)

PMID Text
26969727 When intersecting microtubules are parallel, Kif15 motors can drive (biased) parallel sliding because the motor simultaneously steps on both microtubules that it cross-links.
25127142 Eg5, Kif15, and dynein work together to build a bipolar spindle and reveal an important role for antagonistic motors in chromosome segregation.
24668168 These data reveal that hKif15 is a plus-end-directed processive homotetramer that can step against loads of up to 3.5 pN.
24659801 regulates alpha2 integrin internalization
24419385 Although Kif15 contains ADP in the catalytic site, its motor-domain structure was captured in the ;ATP-like' configuration, with the neck linker docked to the catalytic core.
23791727 By examining Kif15 activity in two cellular contexts, it was found that Kif15 bound to kinetochore fibers antagonizes centrosome separation while Kif15 bound to nonkinetochore MTs mediates centrosome separation.
22024925 Pole separation depends on Hklp2/Kif15, an otherwise dispensable plus end-directed spindle motor and results in spindles with two centrosomal poles.
19818619 Hklp2 participates in the assembly and stabilization of the bipolar spindle.
19818618 Kif15 can replace all essential functions of Eg5 in bipolar spindle assembly.

AA Sequence

MAPGCKTELRSVTNGQSNQPSNEGDAIKVFVRIRPPAERSGSADGEQNLCLSVLSSTSLRLHSNPEPKTF      1 - 70
TFDHVADVDTTQESVFATVAKSIVESCMSGYNGTIFAYGQTGSGKTFTMMGPSESDNFSHNLRGVIPRSF     71 - 140
EYLFSLIDREKEKAGAGKSFLCKCSFIEIYNEQIYDLLDSASAGLYLREHIKKGVFVVGAVEQVVTSAAE    141 - 210
AYQVLSGGWRNRRVASTSMNRESSRSHAVFTITIESMEKSNEIVNIRTSLLNLVDLAGSERQKDTHAEGM    211 - 280
RLKEAGNINRSLSCLGQVITALVDVGNGKQRHVCYRDSKLTFLLRDSLGGNAKTAIIANVHPGSRCFGET    281 - 350
LSTLNFAQRAKLIKNKAVVNEDTQGNVSQLQAEVKRLKEQLAELASGQTPPESFLTRDKKKTNYMEYFQE    351 - 420
AMLFFKKSEQEKKSLIEKVTQLEDLTLKKEKFIQSNKMIVKFREDQIIRLEKLHKESRGGFLPEEQDRLL    421 - 490
SELRNEIQTLREQIEHHPRVAKYAMENHSLREENRRLRLLEPVKRAQEMDAQTIAKLEKAFSEISGMEKS    491 - 560
DKNQQGFSPKAQKEPCLFANTEKLKAQLLQIQTELNNSKQEYEEFKELTRKRQLELESELQSLQKANLNL    561 - 630
ENLLEATKACKRQEVSQLNKIHAETLKIITTPTKAYQLHSRPVPKLSPEMGSFGSLYTQNSSILDNDILN    631 - 700
EPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVDKLEHHSTQMQELFSSERIDWTK    701 - 770
QQEELLSQLNVLEKQLQETQTKNDFLKSEVHDLRVVLHSADKELSSVKLEYSSFKTNQEKEFNKLSERHM    771 - 840
HVQLQLDNLRLENEKLLESKACLQDSYDNLQEIMKFEIDQLSRNLQNFKKENETLKSDLNNLMELLEAEK    841 - 910
ERNNKLSLQFEEDKENSSKEILKVLEAVRQEKQKETAKCEQQMAKVQKLEESLLATEKVISSLEKSRDSD    911 - 980
KKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR    981 - 1050
ILSEDIERDMLCEDLAHATEQLNMLTEASKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNE   1051 - 1120
YNFKMRQLEHVMDSAAEDPQSPKTPPHFQTHLAKLLETQEQEIEDGRASKTSLEHLVTKLNEDREVKNAE   1121 - 1190
ILRMKEQLREMENLRLESQQLIEKNWLLQGQLDDIKRQKENSDQNHPDNQQLKNEQEESIKERLAKSKIV   1191 - 1260
EEMLKMKADLEEVQSALYNKEMECLRMTDEVERTQTLESKAFQEKEQLRSKLEEMYEERERTSQEMEMLR   1261 - 1330
KQVECLAEENGKLVGHQNLHQKIQYVVRLKKENVRLAEETEKLRAENVFLKEKKRSES               1331 - 1388
//

Text Mined References (24)

PMID Year Title
26969727 2016 Kinesin-12 motors cooperate to suppress microtubule catastrophes and drive the formation of parallel microtubule bundles.
25127142 2014 Balanced activity of three mitotic motors is required for bipolar spindle assembly and chromosome segregation.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24668168 2014 The Kinesin-12 Kif15 is a processive track-switching tetramer.
24659801 2014 An RNAi screen identifies KIF15 as a novel regulator of the endocytic trafficking of integrin.
24419385 2014 The crystal structure and biochemical characterization of Kif15: a bifunctional molecular motor involved in bipolar spindle formation and neuronal development.
23791727 2013 Kinesin-12 differentially affects spindle assembly depending on its microtubule substrate.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22024925 2011 Modulated microtubule dynamics enable Hklp2/Kif15 to assemble bipolar spindles.
21269460 2011 Initial characterization of the human central proteome.
More...