Property Summary

NCBI Gene PubMed Count 20
PubMed Score 30.27
PubTator Score 18.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adrenocortical carcinoma 1.568 2.4e-03
adult high grade glioma 2.100 2.1e-05
Atopic dermatitis 1.500 9.4e-06
atypical teratoid / rhabdoid tumor 2.600 8.9e-08
Breast cancer 2.700 2.0e-18
ductal carcinoma in situ 1.700 8.4e-03
Endometriosis 2.032 1.1e-02
ependymoma 1.500 7.2e-05
glioblastoma 2.600 9.1e-09
group 3 medulloblastoma 4.000 2.6e-09
intraductal papillary-mucinous carcinoma... 2.800 2.4e-05
intraductal papillary-mucinous neoplasm ... 2.600 1.2e-03
invasive ductal carcinoma 2.000 1.3e-03
lung cancer 2.800 6.4e-05
malignant mesothelioma 1.900 9.4e-07
medulloblastoma, large-cell 3.000 1.2e-06
nasopharyngeal carcinoma 1.400 6.8e-05
non-small cell lung cancer 2.161 5.9e-25
oligodendroglioma 1.200 2.2e-06
ovarian cancer 2.000 6.5e-05
primitive neuroectodermal tumor 3.200 1.9e-06
psoriasis 1.300 8.2e-03

Gene RIF (13)

AA Sequence

MAPGCKTELRSVTNGQSNQPSNEGDAIKVFVRIRPPAERSGSADGEQNLCLSVLSSTSLRLHSNPEPKTF      1 - 70
TFDHVADVDTTQESVFATVAKSIVESCMSGYNGTIFAYGQTGSGKTFTMMGPSESDNFSHNLRGVIPRSF     71 - 140
EYLFSLIDREKEKAGAGKSFLCKCSFIEIYNEQIYDLLDSASAGLYLREHIKKGVFVVGAVEQVVTSAAE    141 - 210
AYQVLSGGWRNRRVASTSMNRESSRSHAVFTITIESMEKSNEIVNIRTSLLNLVDLAGSERQKDTHAEGM    211 - 280
RLKEAGNINRSLSCLGQVITALVDVGNGKQRHVCYRDSKLTFLLRDSLGGNAKTAIIANVHPGSRCFGET    281 - 350
LSTLNFAQRAKLIKNKAVVNEDTQGNVSQLQAEVKRLKEQLAELASGQTPPESFLTRDKKKTNYMEYFQE    351 - 420
AMLFFKKSEQEKKSLIEKVTQLEDLTLKKEKFIQSNKMIVKFREDQIIRLEKLHKESRGGFLPEEQDRLL    421 - 490
SELRNEIQTLREQIEHHPRVAKYAMENHSLREENRRLRLLEPVKRAQEMDAQTIAKLEKAFSEISGMEKS    491 - 560
DKNQQGFSPKAQKEPCLFANTEKLKAQLLQIQTELNNSKQEYEEFKELTRKRQLELESELQSLQKANLNL    561 - 630
ENLLEATKACKRQEVSQLNKIHAETLKIITTPTKAYQLHSRPVPKLSPEMGSFGSLYTQNSSILDNDILN    631 - 700
EPVPPEMNEQAFEAISEELRTVQEQMSALQAKLDEEEHKNLKLQQHVDKLEHHSTQMQELFSSERIDWTK    701 - 770
QQEELLSQLNVLEKQLQETQTKNDFLKSEVHDLRVVLHSADKELSSVKLEYSSFKTNQEKEFNKLSERHM    771 - 840
HVQLQLDNLRLENEKLLESKACLQDSYDNLQEIMKFEIDQLSRNLQNFKKENETLKSDLNNLMELLEAEK    841 - 910
ERNNKLSLQFEEDKENSSKEILKVLEAVRQEKQKETAKCEQQMAKVQKLEESLLATEKVISSLEKSRDSD    911 - 980
KKVVADLMNQIQELRTSVCEKTETIDTLKQELKDINCKYNSALVDREESRVLIKKQEVDILDLKETLRLR    981 - 1050
ILSEDIERDMLCEDLAHATEQLNMLTEASKKHSGLLQSAQEELTKKEALIQELQHKLNQKKEEVEQKKNE   1051 - 1120
YNFKMRQLEHVMDSAAEDPQSPKTPPHFQTHLAKLLETQEQEIEDGRASKTSLEHLVTKLNEDREVKNAE   1121 - 1190
ILRMKEQLREMENLRLESQQLIEKNWLLQGQLDDIKRQKENSDQNHPDNQQLKNEQEESIKERLAKSKIV   1191 - 1260
EEMLKMKADLEEVQSALYNKEMECLRMTDEVERTQTLESKAFQEKEQLRSKLEEMYEERERTSQEMEMLR   1261 - 1330
KQVECLAEENGKLVGHQNLHQKIQYVVRLKKENVRLAEETEKLRAENVFLKEKKRSES               1331 - 1388
//

Text Mined References (28)

PMID Year Title