Property Summary

NCBI Gene PubMed Count 17
PubMed Score 15.85
PubTator Score 24.53

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 1.2e-03
Astrocytoma, Pilocytic -1.100 9.1e-06
atypical teratoid / rhabdoid tumor -1.800 2.3e-07
glioblastoma -1.400 9.1e-05
lung cancer 1.200 9.3e-04
medulloblastoma, large-cell -1.100 1.9e-03
pituitary cancer 1.200 5.7e-06
posterior fossa group A ependymoma -1.100 2.1e-08
psoriasis 1.100 4.3e-17

Gene RIF (8)

AA Sequence

MGETMSKRLKLHLGGEAEMEERAFVNPFPDYEAAAGALLASGAAEETGCVRPPATTDEPGLPFHQDGKII      1 - 70
HNFIRRIQTKIKDLLQQMEEGLKTADPHDCSAYTGWTGIALLYLQLYRVTCDQTYLLRSLDYVKRTLRNL     71 - 140
NGRRVTFLCGDAGPLAVGAVIYHKLRSDCESQECVTKLLQLQRSVVCQESDLPDELLYGRAGYLYALLYL    141 - 210
NTEIGPGTVCESAIKEVVNAIIESGKTLSREERKTERCPLLYQWHRKQYVGAAHGMAGIYYMLMQPAAKV    211 - 280
DQETLTEMVKPSIDYVRHKKFRSGNYPSSLSNETDRLVHWCHGAPGVIHMLMQAYKVFKEEKYLKEAMEC    281 - 350
SDVIWQRGLLRKGYGICHGTAGNGYSFLSLYRLTQDKKYLYRACKFAEWCLDYGAHGCRIPDRPYSLFEG    351 - 420
MAGAIHFLSDVLGPETSRFPAFELDSSKRD                                            421 - 450
//

Text Mined References (21)

PMID Year Title