Property Summary

NCBI Gene PubMed Count 23
Grant Count 19
R01 Count 1
Funding $6,607,124.75
PubMed Score 377.38
PubTator Score 47.84

Knowledge Summary

Patent

No data available

Expression

Gene RIF (8)

PMID Text
26507551 Two African-ancestry specific variants were found to be significantly associated with metabolic syndrome S: SNP rs73989312[A] near CA10 that conferred increased risk; and SNP rs77244975[C] in CTNNA3 that conferred protection against this disease.
25880085 Copy number deletion on CA10 was associated with a 1.69-fold decreased risk for osteoarthritis.
24407380 our results suggest that genes CA10 and also SGK493 may be an important risk factor for asthma development, especially for a nonatopic phenotype.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)
19172221 The results suggest that the variations of CA8 and CA10 loci may be important determinants of osteoporosis in Japanese women.
19172221 Observational study of gene-disease association. (HuGE Navigator)
9921901 Identifies a string of seven CCG repeats in the 5' UTR of a carbonic anhydrase X cDNA from human brain.

AA Sequence

MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVN      1 - 70
IETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDS     71 - 140
QGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITY    141 - 210
KNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFL    211 - 280
SMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK                          281 - 328
//

Text Mined References (25)

PMID Year Title
26507551 2015 Genome-wide association study identifies African-ancestry specific variants for metabolic syndrome.
25880085 2015 A genome-wide association study of copy-number variation identifies putative loci associated with osteoarthritis in Koreans.
25317112 2014 Epidemiological and genome-wide association study of gastritis or gastric ulcer in korean populations.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
24407380 2014 Polymorphisms in recent GWA identified asthma genes CA10, SGK493, and CTNNA3 are associated with disease severity and treatment response in childhood asthma.
23400010 2014 Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans.
21102462 2010 Thirty new loci for age at menarche identified by a meta-analysis of genome-wide association studies.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
19172221 2009 Nucleotide variations in genes encoding carbonic anhydrase 8 and 10 associated with femoral bone mineral density in Japanese female with osteoporosis.
More...