Property Summary

NCBI Gene PubMed Count 24
PubMed Score 388.78
PubTator Score 47.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -2.500 3.4e-03
astrocytic glioma -2.200 9.6e-03
Astrocytoma, Pilocytic 1.200 4.3e-02
atypical teratoid / rhabdoid tumor -4.300 1.0e-11
ependymoma -2.300 3.2e-02
glioblastoma -1.900 2.0e-02
group 3 medulloblastoma -1.800 2.0e-02
medulloblastoma, large-cell -1.500 3.8e-02
Pick disease -1.300 6.4e-03
pituitary cancer 1.800 9.9e-07
primitive neuroectodermal tumor -2.700 1.6e-02
subependymal giant cell astrocytoma -4.502 1.2e-03

Gene RIF (9)

AA Sequence

MEIVWEVLFLLQANFIVCISAQQNSPKIHEGWWAYKEVVQGSFVPVPSFWGLVNSAWNLCSVGKRQSPVN      1 - 70
IETSHMIFDPFLTPLRINTGGRKVSGTMYNTGRHVSLRLDKEHLVNISGGPMTYSHRLEEIRLHFGSEDS     71 - 140
QGSEHLLNGQAFSGEVQLIHYNHELYTNVTEAAKSPNGLVVVSIFIKVSDSSNPFLNRMLNRDTITRITY    141 - 210
KNDAYLLQGLNIEELYPETSSFITYDGSMTIPPCYETASWIIMNKPVYITRMQMHSLRLLSQNQPSQIFL    211 - 280
SMSDNFRPVQPLNNRCIRTNINFSLQGKDCPNNRAQKLQYRVNEWLLK                          281 - 328
//

Text Mined References (26)

PMID Year Title