Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.73
PubTator Score 4.49

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.600 4.1e-03
glioblastoma 1.300 7.7e-04
group 3 medulloblastoma -1.700 3.5e-04
invasive ductal carcinoma -1.100 7.7e-03
lung cancer -1.400 3.5e-04
medulloblastoma, large-cell -1.200 4.3e-03
tuberculosis -1.400 1.8e-05

Gene RIF (2)

AA Sequence

MKGRRRRRREYCKFALLLVLYTLVLLLVPSVLDGGRDGDKGAEHCPGLQRSLGVWSLEAAAAGEREQGAE      1 - 70
ARAAEEGGANQSPRFPSNLSGAVGEAVSREKQHIYVHATWRTGSSFLGELFNQHPDVFYLYEPMWHLWQA     71 - 140
LYPGDAESLQGALRDMLRSLFRCDFSVLRLYAPPGDPAARAPDTANLTTAALFRWRTNKVICSPPLCPGA    141 - 210
PRARAEVGLVEDTACERSCPPVAIRALEAECRKYPVVVIKDVRLLDLGVLVPLLRDPGLNLKVVQLFRDP    211 - 280
RAVHNSRLKSRQGLLRESIQVLRTRQRGDRFHRVLLAHGVGARPGGQSRALPAAPRADFFLTGALEVICE    281 - 350
AWLRDLLFARGAPAWLRRRYLRLRYEDLVRQPRAQLRRLLRFSGLRALAALDAFALNMTRGAAYGADRPF    351 - 420
HLSARDAREAVHAWRERLSREQVRQVEAACAPAMRLLAYPRSGEEGDAEQPREGETPLEMDADGAT        421 - 486
//

Text Mined References (11)

PMID Year Title