Property Summary

NCBI Gene PubMed Count 13
PubMed Score 9.83
PubTator Score 35.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Synonym

Accession Q9NS82 B2RE84 Asc-1
Symbols ASC1
asc-1
HASC-1

Gene

PANTHER Protein Class (2)

Gene RIF (4)

PMID Text
25219498 ASC1 is a target for ufmylation and that UFBP1 is an essential component for ASC1 ufmylation.
25080478 The amino acid transporter ASC-1 is a white adipocyte-specific cell surface protein.
21888942 In conclusion, SLC7A10 had no apparent degree of association with schizophrenia as a candidate susceptibility gene in the disease per se.
15458438 The lack of expression of asc-1 in the proximal tubule indicates that it plays no role in the bulk of renal reabsorption of amino acids

AA Sequence

MAGHTQQPSGRGNPRPAPSPSPVPGTVPGASERVALKKEIGLLSACTIIIGNIIGSGIFISPKGVLEHSG      1 - 70
SVGLALFVWVLGGGVTALGSLCYAELGVAIPKSGGDYAYVTEIFGGLAGFLLLWSAVLIMYPTSLAVISM     71 - 140
TFSNYVLQPVFPNCIPPTTASRVLSMACLMLLTWVNSSSVRWATRIQDMFTGGKLLALSLIIGVGLLQIF    141 - 210
QGHFEELRPSNAFAFWMTPSVGHLALAFLQGSFAFSGWNFLNYVTEEMVDARKNLPRAIFISIPLVTFVY    211 - 280
TFTNIAYFTAMSPQELLSSNAVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTYSRLCFSGAREGHL    281 - 350
PSLLAMIHVRHCTPIPALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLLLLRWRRPALHRPI    351 - 420
KVNLLIPVAYLVFWAFLLVFSFISEPMVCGVGVIIILTGVPIFFLGVFWRSKPKCVHRLTESMTHWGQEL    421 - 490
CFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ                                         491 - 523
//

Text Mined References (14)

PMID Year Title
25219498 2014 Modification of ASC1 by UFM1 is crucial for ER? transactivation and breast cancer development.
25080478 2014 ASC-1, PAT2, and P2RX5 are cell surface markers for white, beige, and brown adipocytes.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
21888942 2011 No genetic association between SLC7A10 and Japanese patients with schizophrenia.
18195088 2008 Amino acid transport across mammalian intestinal and renal epithelia.
15901826 2005 Metabolic activation-related CD147-CD98 complex.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15458438 2004 The amino acid transporter asc-1 is not involved in cystinuria.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...