Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.13
PubTator Score 35.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -1.700 2.7e-04
Astrocytoma, Pilocytic -1.600 1.9e-06
atypical teratoid / rhabdoid tumor -1.700 2.3e-08
ductal carcinoma in situ -2.900 1.2e-04
ependymoma -1.600 4.0e-08
glioblastoma -1.400 1.2e-06
group 3 medulloblastoma -1.800 1.4e-04
invasive ductal carcinoma -2.600 3.8e-03
malignant mesothelioma 3.000 3.0e-08
medulloblastoma, large-cell -1.900 5.1e-06

Protein-protein Interaction (1)

Gene RIF (4)

AA Sequence

MAGHTQQPSGRGNPRPAPSPSPVPGTVPGASERVALKKEIGLLSACTIIIGNIIGSGIFISPKGVLEHSG      1 - 70
SVGLALFVWVLGGGVTALGSLCYAELGVAIPKSGGDYAYVTEIFGGLAGFLLLWSAVLIMYPTSLAVISM     71 - 140
TFSNYVLQPVFPNCIPPTTASRVLSMACLMLLTWVNSSSVRWATRIQDMFTGGKLLALSLIIGVGLLQIF    141 - 210
QGHFEELRPSNAFAFWMTPSVGHLALAFLQGSFAFSGWNFLNYVTEEMVDARKNLPRAIFISIPLVTFVY    211 - 280
TFTNIAYFTAMSPQELLSSNAVAVTFGEKLLGYFSWVMPVSVALSTFGGINGYLFTYSRLCFSGAREGHL    281 - 350
PSLLAMIHVRHCTPIPALLVCCGATAVIMLVGDTYTLINYVSFINYLCYGVTILGLLLLRWRRPALHRPI    351 - 420
KVNLLIPVAYLVFWAFLLVFSFISEPMVCGVGVIIILTGVPIFFLGVFWRSKPKCVHRLTESMTHWGQEL    421 - 490
CFVVYPQDAPEEEENGPCPPSLLPATDKPSKPQ                                         491 - 523
//

Text Mined References (14)

PMID Year Title