Property Summary

Ligand Count 49
NCBI Gene PubMed Count 55
PubMed Score 99.31
PubTator Score 76.28

Knowledge Summary

Patent (30,755)

TINX Plot

  Disease (5)

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 2.500 6.1e-03

Gene RIF (41)

AA Sequence

MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKS      1 - 70
TSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAM     71 - 140
VHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGC    141 - 210
LLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCK    211 - 280
DRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV        281 - 346
//

Text Mined References (55)

PMID Year Title