Property Summary

NCBI Gene PubMed Count 50
Grant Count 51
R01 Count 21
Funding $5,617,104.11
PubMed Score 96.54
PubTator Score 76.28

Knowledge Summary

Patent (30,755)

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 2.500 0.006

Gene RIF (38)

PMID Text
26433531 CysLT2 receptors were expressed in lung specimens isolated from asthma subjects. Activation of CysLT2 receptors may contribute to antigen-induced bronchoconstriction in certain asthma population.
25839425 Autocrine activity of cysteinyl leukotrienes in human vascular endothelial cells: Signaling through the CysLT receptor
25760841 CysLTR-1 and CysLTR-2 are highly expressed in the adenoid tissues from children with AH, suggesting that leukotrienes are involved in the pathogenesis of AH.
24285579 Suggest that endothelial and nonendothelial CysLT2R niches have separate roles in mediating inflammatory responses in ischemic/perfusion injury.
23829413 ATRA treatment induces CysLT(2)R mRNA and protein expression in colon cancer cell lines
23524649 CysLT2 receptor plays a primary role in the vascular responses in the upper respiratory tract.
22634478 increased expression in tonsillar tissues of Chinese children with sleep-disordered breathing
22194989 There is a protective role against tumor progression for CysLT(2)R and that it highlights new possibilities to regulate the CysLT(2)R.
21753081 The synthesis of cys-LTs from LTA(4) by endothelial cells is directly associated with the activation of the CysLT(2) receptor in a typical autocrine fashion.
21352274 Cysteinyl leukotriene receptor 2 gene polymorphism -1220 A/C is not associated with atopic dermatitis or psoriasis vulgaris in Japanese patients.
More...

AA Sequence

MERKFMSLQPSISVSEMEPNGTFSNNNSRNCTIENFKREFFPIVYLIIFFWGVLGNGLSIYVFLQPYKKS      1 - 70
TSVNVFMLNLAISDLLFISTLPFRADYYLRGSNWIFGDLACRIMSYSLYVNMYSSIYFLTVLSVVRFLAM     71 - 140
VHPFRLLHVTSIRSAWILCGIIWILIMASSIMLLDSGSEQNGSVTSCLELNLYKIAKLQTMNYIALVVGC    141 - 210
LLPFFTLSICYLLIIRVLLKVEVPESGLRVSHRKALTTIIITLIIFFLCFLPYHTLRTVHLTTWKVGLCK    211 - 280
DRLHKALVITLALAAANACFNPLLYYFAGENFKDRLKSALRKGHPQKAKTKCVFPVSVWLRKETRV        281 - 346
//

Text Mined References (50)

PMID Year Title
26433531 2015 Expression of CysLT2 receptors in asthma lung, and their possible role in bronchoconstriction.
25839425 2015 Autocrine activity of cysteinyl leukotrienes in human vascular endothelial cells: Signaling through the CysLT? receptor.
25760841 2015 [Expression of CysLTR-1 and CysLTR-2 in adenoid tissues from children with adenoid hypertrophy].
24792382 2014 Genome-wide association study identifies ALLC polymorphisms correlated with FEV? change by corticosteroid.
24285579 2014 Multiple-site activation of the cysteinyl leukotriene receptor 2 is required for exacerbation of ischemia/reperfusion injury.
23829413 2013 The cysteinyl leukotriene 2 receptor contributes to all-trans retinoic acid-induced differentiation of colon cancer cells.
23524649 2013 Localization and up-regulation of cysteinyl leukotriene-2 receptor in human allergic nasal mucosa.
22634478 2012 Increased cysteinyl leukotriene concentration and receptor expression in tonsillar tissues of Chinese children with sleep-disordered breathing.
22194989 2011 Regulation of cysteinyl leukotriene receptor 2 expression--a potential anti-tumor mechanism.
21753081 2011 Synthesis of cysteinyl leukotrienes in human endothelial cells: subcellular localization and autocrine signaling through the CysLT2 receptor.
More...