Property Summary

NCBI Gene PubMed Count 13
Grant Count 1
Funding $13,548.5
PubMed Score 4.59
PubTator Score 2.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (2)

Disease log2 FC p
non-small cell lung cancer -1.182 0.000
lung cancer -1.500 0.000

Synonym

Accession Q9NS73 Q86TZ2 Q96AS5 Q9BS93 Q9NZE1
Symbols

Gene

 Grant Application (1)

AA Sequence

MAAATELNRPSSGDRNLERRCRPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKLQSLSAFQPAL      1 - 70
LFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFSIGDLQEEEKHKESDLRDVKK     71 - 140
TQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVIDCNQENSCARTDAIFTPYPGFKSH    141 - 210
VKVSRVVNTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLED    211 - 280
KILELEGISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP          281 - 344
//

Text Mined References (21)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25416956 2014 A proteome-scale map of the human interactome network.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
23408906 2013 A meta-analysis of thyroid-related traits reveals novel loci and gender-specific differences in the regulation of thyroid function.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22267200 2012 Discovery of common variants associated with low TSH levels and thyroid cancer risk.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19103755 2009 The double-histone-acetyltransferase complex ATAC is essential for mammalian development.
19060904 2009 An empirical framework for binary interactome mapping.
18838386 2008 Human ATAC Is a GCN5/PCAF-containing acetylase complex with a novel NC2-like histone fold module that interacts with the TATA-binding protein.
More...