Property Summary

NCBI Gene PubMed Count 15
PubMed Score 5.94
PubTator Score 2.66

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
non-small cell lung cancer 2890 5.7e-14
lung cancer 4740 1.4e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Thyroid cancer 36 0.0 3.0
Disease Target Count
Chorea, Benign Hereditary 3

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.300 1.4e-02
non-small cell lung cancer -1.182 5.7e-14

AA Sequence

MAAATELNRPSSGDRNLERRCRPNLSREVLYEIFRSLHTLVGQLDLRDDVVKITIDWNKLQSLSAFQPAL      1 - 70
LFSALEQHILYLQPFLAKLQSPIKEENTTAVEEIGRTEMGNKNEVNDKFSIGDLQEEEKHKESDLRDVKK     71 - 140
TQIHFDPEVVQIKAGKAEIDRRISAFIERKQAEINENNVREFCNVIDCNQENSCARTDAIFTPYPGFKSH    141 - 210
VKVSRVVNTYGPQTRPEGIPGSGHKPNSMLRDCGNQAVEERLQNIEAHLRLQTGGPVPRDIYQRIKKLED    211 - 280
KILELEGISPEYFQSVSFSGKRRKVQPPQQNYSLAELDEKISALKQALLRKSREAESMATHHLP          281 - 344
//

Text Mined References (24)

PMID Year Title