Property Summary

NCBI Gene PubMed Count 40
PubMed Score 66.41
PubTator Score 41.13

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Adenocarcinoma 122 0.0 0.0
Ovarian Cysts 41 0.0 0.0
Stomach Neoplasms 300 0.0 0.0
Disease Target Count Z-score Confidence
lung cancer 4740 0.0 1.0
Disease Target Count Z-score Confidence
Gastritis 47 3.628 1.8

Expression

  Differential Expression (3)

Disease log2 FC p
interstitial cystitis -1.800 4.2e-02
intraductal papillary-mucinous adenoma (... 6.300 1.1e-05
malignant mesothelioma -1.300 5.4e-04

Synonym

Accession Q9NS71 Q8IUA9
Symbols FOV
CA11
AMP18
BRICD1
foveolin

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (32)

AA Sequence

MLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNG      1 - 70
WDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPN     71 - 140
KVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN               141 - 199
//

Text Mined References (42)

PMID Year Title