Property Summary

NCBI Gene PubMed Count 36
Grant Count 22
R01 Count 2
Funding $5,496,341.2
PubMed Score 61.38
PubTator Score 41.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
malignant mesothelioma -1.300 0.001
intraductal papillary-mucinous adenoma (... 6.300 0.000
interstitial cystitis -1.800 0.042

Gene RIF (28)

PMID Text
26008777 Gastrokine 1 indirectly participates in actin stabilization since its overexpression in gastric cancer cells strongly increases the expression of tight and adherens junction proteins
25999661 Results suggest a potential association between CRP and GPC5 variants with lung cancer risk; variation in GKN1 is associated with chemotherapy response in the Chinese Han population.
25919700 AMP-18 appears to act through PI3K/AKT pathways to increase p21 phosphorylation, thereby reducing its nuclear accumulation to overcome the antiproliferative effects of TNF-alpha.
25725220 GKN1 inhibits metastasis in gastric cancer cells.
25469040 GKN1 expression in the gastric mucosa of gastric cancer patients is decreased; this is associated with progression and prognosis of gastric cancer.
25344918 GKN1 may shorten telomeres by acting as a potential c-myc inhibitor that eventually leads to senescence and apoptosis in gastric cancer cells
25239641 These results suggest that GKN1 might be a target to inhibit the effects from H.pylori CagA.
25139219 Data show that recombinant gastrokine 1 (GKN1) interacts with amyloid-beta peptide (1-40) preventing its aggregation.
24460791 Epstein-Barr virus EBNA1 binds to the divergent promoter of the GKN1 and GKN2 genes and contributes to the complex transcriptional and epigenetic deregulation of the GKN1 and GKN2 tumor suppressor genes.
24151046 These data demonstrate that in the presence of GKN2, GKN1 loses its ability to decrease cell proliferation, induce apoptosis, and inhibit epigenetic alterations in gastric cancer cells.
More...

AA Sequence

MLAYSSVHCFREDKMKFTIVFAGLLGVFLAPALANYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNG      1 - 70
WDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPN     71 - 140
KVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN               141 - 199
//

Text Mined References (38)

PMID Year Title
26008777 2015 Ectopic expression of gastrokine 1 in gastric cancer cells up-regulates tight and adherens junction proteins network.
25999661 2015 Polymorphisms in C-reactive protein and Glypican-5 are associated with lung cancer risk and Gartrokine-1 influences Cisplatin-based chemotherapy response in a Chinese Han population.
25919700 2015 AMP-18 Targets p21 to Maintain Epithelial Homeostasis.
25725220 2015 GKN1 inhibits cell invasion in gastric cancer by inactivating the NF-kappaB pathway.
25469040 2014 Decreased expression of gastrokine 1 in gastric mucosa of gastric cancer patients.
25344918 2014 Gastrokine 1 induces senescence and apoptosis through regulating telomere length in gastric cancer.
25239641 2014 Gastrokine 1 inhibits the carcinogenic potentials of Helicobacter pylori CagA.
25139219 2014 Anti-amyloidogenic property of human gastrokine 1.
24460791 2014 EBNA1 binding and epigenetic regulation of gastrokine tumor suppressor genes in gastric carcinoma cells.
24151046 2014 GKN2 contributes to the homeostasis of gastric mucosa by inhibiting GKN1 activity.
More...