Property Summary

NCBI Gene PubMed Count 24
PubMed Score 48.04
PubTator Score 28.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.1e-02
Breast cancer 3.600 3.1e-02
diabetes mellitus -1.100 1.1e-03
group 3 medulloblastoma 1.400 3.5e-02
non primary Sjogren syndrome sicca 1.100 1.5e-02
osteosarcoma 1.302 9.7e-04
pituitary cancer 1.100 1.0e-05

Gene RIF (11)

AA Sequence

MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLS      1 - 70
LFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPG     71 - 140
KI                                                                        141 - 142
//

Text Mined References (33)

PMID Year Title