Property Summary

NCBI Gene PubMed Count 23
Grant Count 13
R01 Count 5
Funding $383,154.41
PubMed Score 45.87
PubTator Score 28.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
osteosarcoma 1.302 0.001
atypical teratoid / rhabdoid tumor -1.100 0.011
diabetes mellitus -1.100 0.001
Breast cancer 3.600 0.031
group 3 medulloblastoma 1.400 0.035
non primary Sjogren syndrome sicca 1.100 0.015
pituitary cancer 1.100 0.000

Gene RIF (11)

PMID Text
26787839 Tom22 is essential for metabolic conversion, as its knockdown by small interfering RNA (siRNA) completely ablated progesterone conversion in both steroidogenic mouse Leydig MA-10 and human adrenal NCI cells.
24886575 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
24886575 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
24149440 Blockade of mitochondrial protein import triggers the recruitment of PARK2, by PINK1, to the TOMM machinery.
23874603 HIV-1 PR interacts with mitochondrial proteins VDAC, cytochrome c, TOM22, and Bax in HeLa cells
22198199 The interaction with the cytosolic domain of Tom22 helps Bax to acquire a conformation able to interact with the outer mitochondrial membrane.
22178394 Studies indicate that PUMA and TOMM22 as potential targets for miRNA-BART viral transcripts.
20877624 Observational study of gene-disease association. (HuGE Navigator)
17096026 We have identified TOM22, a component of the translocase of the outer mitochondrial membrane (TOM), as a mitochondrial receptor of Bax.
14699115 the cytosolic domains of Tom20 and Tom22 function to maintain their substrate preproteins unfolded and prevent them from aggregating on the mitochondrial surface
More...

AA Sequence

MAAAVAAAGAGEPQSPDELLPKGDAEKPEEELEEDDDEELDETLSERLWGLTEMFPERVRSAAGATFDLS      1 - 70
LFVAQKMYRFSRAALWIGTTSFMILVLPVVFETEKLQMEQQQQLQQRQILLGPNTGLSGGMPGALPSLPG     71 - 140
KI                                                                        141 - 142
//

Text Mined References (32)

PMID Year Title
26787839 2016 An Outer Mitochondrial Translocase, Tom22, Is Crucial for Inner Mitochondrial Steroidogenic Regulation in Adrenal and Gonadal Tissues.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25556234 2015 New host factors important for respiratory syncytial virus (RSV) replication revealed by a novel microfluidics screen for interactors of matrix (M) protein.
24149440 2013 The TOMM machinery is a molecular switch in PINK1 and PARK2/PARKIN-dependent mitochondrial clearance.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
22198199 2012 The cytosolic domain of human Tom22 modulates human Bax mitochondrial translocation and conformation in yeast.
22178394 2012 The role of miRNAs and EBV BARTs in NPC.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...