Property Summary

NCBI Gene PubMed Count 26
Grant Count 19
R01 Count 16
Funding $719,231.54
PubMed Score 35.44
PubTator Score 151.77

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
24623448 TNFRSF19 may contribute to the development of colorectal tumors with deregulated beta-catenin activity.
24129566 the association of RhoGDIalpha with TROY contributed to TROY-dependent RhoA activation and neurite outgrowth inhibition after Nogo-66 stimulation.
23699535 Results show aberrant expression and/or signaling by TROY as a contributor to the dispersion of glioblastoma cells and therapeutic resistance.
23142137 TROY is up-regulated in human colorectal cancer cell lines and in intestinal tumors in mice. It functions as a negative modulator of the Wnt pathway in LGR5-positive stem cells.
22057614 study demonstrated that TNFR2 and TROY mRNA levels are enhanced in cutaneous squamous cell carcinoma cells compared to healthy ones in a Tunisian population
21127458 The FAM134B and TNFRSF19 showed a dramatically strong synergistic epistasis in explaining the genetic dissection of the susceptibility to complex vascular dementia.
20881009 TNFRSF19 overexpression in glioma cells activates Rac1 signaling in a Pyk2-dependent manner to drive glioma cell invasion and migration
20512145 Findings provide new insights into the pathogenesis of NPC by highlighting the involvement of pathways related to TNFRSF19 and MDS1-EVI1 in addition to HLA molecules.
20512145 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20237496 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDA      1 - 70
QCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGD     71 - 140
PPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPSWSLRSQD    141 - 210
IQYNGSELSCFDRPQLHEYAHRACCQCRRDSVQTCGPVRLLPSMCCEEACSPNPATLGCGVHSAASLQAR    211 - 280
NAGPAGEMVPTFFGSLTQSICGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSN    281 - 350
SSQDLVGGAVPVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQESGAVIHPATQTSLQVRQRL    351 - 420
GSL                                                                       421 - 423
//

Text Mined References (29)

PMID Year Title
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
24623448 2014 ?-catenin regulates NF-?B activity via TNFRSF19 in colorectal cancer cells.
24129566 2013 TROY interacts with Rho guanine nucleotide dissociation inhibitor ? (RhoGDI?) to mediate Nogo-induced inhibition of neurite outgrowth.
23699535 2013 TROY (TNFRSF19) promotes glioblastoma survival signaling and therapeutic resistance.
23142137 2013 Troy, a tumor necrosis factor receptor family member, interacts with lgr5 to inhibit wnt signaling in intestinal stem cells.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
22493691 2012 Novel associations for hypothyroidism include known autoimmune risk loci.
22057614 2011 Tumor necrosis factor-receptor 2 and TROY gene expression patterns in cutaneous squamous cell carcinoma in a Tunisian population.
21127458 2011 A strong synergistic epistasis between FAM134B and TNFRSF19 on the susceptibility to vascular dementia.
20881009 2010 TROY (TNFRSF19) is overexpressed in advanced glial tumors and promotes glioblastoma cell invasion via Pyk2-Rac1 signaling.
More...