Property Summary

NCBI Gene PubMed Count 26
PubMed Score 38.99
PubTator Score 151.77

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
adult high grade glioma 2.600 3.5e-04
astrocytic glioma 1.700 2.9e-03
Astrocytoma, Pilocytic 2.600 9.3e-09
atypical teratoid / rhabdoid tumor 2.500 1.8e-04
Breast cancer -2.000 4.9e-05
cystic fibrosis 2.272 4.6e-06
ependymoma 1.500 2.3e-02
glioblastoma 2.700 5.5e-08
intraductal papillary-mucinous adenoma (... -1.500 3.9e-03
intraductal papillary-mucinous carcinoma... -1.600 5.2e-03
medulloblastoma, large-cell 1.900 6.3e-03
nasopharyngeal carcinoma -1.300 4.1e-02
oligodendroglioma 1.600 6.1e-03
osteosarcoma 1.431 3.8e-02
ovarian cancer 2.300 8.7e-04
periodontitis -1.100 5.5e-17
pituitary cancer -2.300 6.9e-05
primitive neuroectodermal tumor 2.400 1.1e-03
psoriasis 1.100 1.3e-02
sonic hedgehog group medulloblastoma 2.300 1.7e-04

Gene RIF (13)

AA Sequence

MALKVLLEQEKTFFTLLVLLGYLSCKVTCESGDCRQQEFRDRSGNCVPCNQCGPGMELSKECGFGYGEDA      1 - 70
QCVTCRLHRFKEDWGFQKCKPCLDCAVVNRFQKANCSATSDAICGDCLPGFYRKTKLVGFQDMECVPCGD     71 - 140
PPPPYEPHCASKVNLVKIASTASSPRDTALAAVICSALATVLLALLILCVIYCKRQFMEKKPSWSLRSQD    141 - 210
IQYNGSELSCFDRPQLHEYAHRACCQCRRDSVQTCGPVRLLPSMCCEEACSPNPATLGCGVHSAASLQAR    211 - 280
NAGPAGEMVPTFFGSLTQSICGEFSDAWPLMQNPMGGDNISFCDSYPELTGEDIHSLNPELESSTSLDSN    281 - 350
SSQDLVGGAVPVQSHSENFTAATDLSRYNNTLVESASTQDALTMRSQLDQESGAVIHPATQTSLQVRQRL    351 - 420
GSL                                                                       421 - 423
//

Text Mined References (29)

PMID Year Title