Property Summary

NCBI Gene PubMed Count 6
Grant Count 2
Funding $25,674.34
PubMed Score 3.47
PubTator Score 2.15

Knowledge Summary

Patent (266)

Expression

  Differential Expression (7)

Disease log2 FC p
oligodendroglioma 1.400 0.017
osteosarcoma 1.221 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
glioblastoma 1.200 0.000
medulloblastoma 1.300 0.003
medulloblastoma, large-cell 1.500 0.000
primitive neuroectodermal tumor 1.200 0.000

Synonym

Accession Q9NS66 B1B0A5
Symbols SREB3

Gene

PANTHER Protein Class (2)

 Grant Application (2)

  TechDev Info (3)

Bryan Roth functional assay
Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available
Steve Finkbeiner Neurite and survival phenotype identified

AA Sequence

MANTTGEPEEVSGALSPPSASAYVKLVLLGLIMCVSLAGNAILSLLVLKERALHKAPYYFLLDLCLADGI      1 - 70
RSAVCFPFVLASVRHGSSWTFSALSCKIVAFMAVLFCFHAAFMLFCISVTRYMAIAHHRFYAKRMTLWTC     71 - 140
AAVICMAWTLSVAMAFPPVFDVGTYKFIREEDQCIFEHRYFKANDTLGFMLMLAVLMAATHAVYGKLLLF    141 - 210
EYRHRKMKPVQMVPAISQNWTFHGPGATGQAAANWIAGFGRGPMPPTLLGIRQNGHAASRRLLGMDEVKG    211 - 280
EKQLGRMFYAITLLFLLLWSPYIVACYWRVFVKACAVPHRYLATAVWMSFAQAAVNPIVCFLLNKDLKKC    281 - 350
LRTHAPCWGTGGAPAPREPYCVM                                                   351 - 373
//

Text Mined References (7)

PMID Year Title
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10833454 2000 An evolutionarily conserved G-protein coupled receptor family, SREB, expressed in the central nervous system.
8889548 1996 Normalization and subtraction: two approaches to facilitate gene discovery.