Property Summary

NCBI Gene PubMed Count 19
PubMed Score 23.37
PubTator Score 19.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
malignant mesothelioma 3.400 0.000
osteosarcoma 1.104 0.011
posterior fossa group B ependymoma -2.300 0.000
glioblastoma -1.700 0.016
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma -1.800 0.007
primitive neuroectodermal tumor -1.600 0.050
adrenocortical carcinoma -1.223 0.038
adult high grade glioma -1.400 0.034
pilocytic astrocytoma -1.200 0.011
lung carcinoma 3.200 0.000
gastric carcinoma -2.600 0.006
ovarian cancer -1.200 0.000
pituitary cancer -2.800 0.000
facioscapulohumeral dystrophy 2.500 0.001

Gene RIF (13)

PMID Text
26823831 The DNA methylation of both Reprimo and hMLH1 genes depressed the protein expression, and may participate in the occurrence and progression and gastric cancer
25954972 Positive association between RPRM and p73 expression suggest that other members of the p53 gene family may participate in the regulation of RPRM expression.
25954972 Loss of expression of Reprimo (RPRM), a p53-induced cell cycle arrest gene correlates with invasive stage of tumor progression and p73 expression in gastric cancer. These findings suggest that other members of the p53 gene family may participate in the regulation of RPRM expression
25629980 tp53-dependent G2 arrest mediator candidate gene, Reprimo, is down-regulated by promoter hypermethylation in pediatric acute myeloid leukemia
23982217 Reprimo expression is normally induced in response to DNA damage, acting as a novel tumor suppressor in gastric cancer; however, Reprimo methylation abrogates its expression and effects
23312294 study concludes that LMP-1 may induce cell cycle arrest at G(2)/M progression via upregulation of 14-3-3sigma and Reprimo
22562171 RPRM is transiently up-regulated at a posttranscriptional level in times of cellular stress to restrict cell survival, proliferation, and tumor formation
20949468 Loss of Reprimo and S100A2 expressions occurs frequently in gastric adenocarcinomas. The expressions of Reprimo and S100A2 may be potential biomarkers for gastric adenocarcinomas detection.
19917725 these data implicate a novel role for HDAC7 and FoxA1 in estrogen repression of RPRM.
18829507 Aberrant hypermethylation of Reprimo is high in primary gastric cancer as well as in pair plasma samples. In plasma from asymptomatic controls, Reprimo is infrequently methylated. Reprimo is a potential biomarker for early detection of gastric cancer.
More...

AA Sequence

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV      1 - 70
FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY                                    71 - 109
//

Text Mined References (22)

PMID Year Title
26823831 2015 Implication of Reprimo and hMLH1 gene methylation in early diagnosis of gastric carcinoma.
25954972 2015 Loss of Expression of Reprimo, a p53-induced Cell Cycle Arrest Gene, Correlates with Invasive Stage of Tumor Progression and p73 Expression in Gastric Cancer.
25629980 2015 tp53-dependent G2 arrest mediator candidate gene, Reprimo, is down-regulated by promoter hypermethylation in pediatric acute myeloid leukemia.
25416956 2014 A proteome-scale map of the human interactome network.
23982217 2013 DNA damage-inducible gene, reprimo functions as a tumor suppressor and is suppressed by promoter methylation in gastric cancer.
23720494 2013 Genome-wide association study identifies loci affecting blood copper, selenium and zinc.
23312294 2012 Epstein-Barr virus-encoded latent membrane protein-1 upregulates 14-3-3? and Reprimo to confer G(2)/M phase cell cycle arrest.
22562171 2012 Reprimo (RPRM) is a novel tumor suppressor in pituitary tumors and regulates survival, proliferation, and tumorigenicity.
20949468 2011 Loss of Reprimo and S100A2 expression in human gastric adenocarcinoma.
19917725 2010 Histone deacetylase 7 and FoxA1 in estrogen-mediated repression of RPRM.
More...