Property Summary

NCBI Gene PubMed Count 21
PubMed Score 24.70
PubTator Score 19.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adrenocortical carcinoma -1.223 3.8e-02
adult high grade glioma -1.400 3.4e-02
Astrocytoma, Pilocytic -1.300 9.0e-03
atypical teratoid / rhabdoid tumor -2.300 4.2e-04
ependymoma -1.600 3.5e-03
facioscapulohumeral dystrophy 2.500 1.2e-03
gastric carcinoma -2.600 6.4e-03
glioblastoma -1.200 9.2e-03
lung carcinoma 3.200 8.5e-16
malignant mesothelioma 3.400 8.4e-08
medulloblastoma -1.800 7.1e-03
osteosarcoma 1.104 1.1e-02
ovarian cancer -1.200 2.1e-07
pituitary cancer -2.800 1.7e-04
primitive neuroectodermal tumor -1.600 5.0e-02

Gene RIF (15)

AA Sequence

MNPALGNQTDVAGLFLANSSEALERAVRCCTQASVVTDDGFAEGGPDERSLYIMRVVQIAVMCVLSLTVV      1 - 70
FGIFFLGCNLLIKSEGMINFLVKDRRPSKEVEAVVVGPY                                    71 - 109
//

Text Mined References (24)

PMID Year Title