Property Summary

NCBI Gene PubMed Count 11
Grant Count 2
Funding $154,000
PubMed Score 4.88
PubTator Score 3.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (3)

Expression

  Differential Expression (1)

Disease log2 FC p
lung adenocarcinoma -1.100 0.000

Synonym

Accession Q9NS62 A2A3J3 B2RCF5 Q6P3U1 Q6UXZ2
Symbols TMTSP
UNQ3010

Gene

 Grant Application (2)

Gene RIF (4)

PMID Text
22664866 The THSD1 gene may play a role in the tumorigenesis of colorectal cancer
18403638 These findings suggest that THSD1 is a good candidate tumor suppressor gene.
17047544 The strong immunolocalization of thrombospondin (TSP) in the outer anulus of the intervertebral disc indicates a role for TSP in the avascular status of the adult human disc.
15371459 Thrombospondin has a role in inducing RhoA inactivation through FAK-dependent signaling to stimulate focal adhesion disassembly

AA Sequence

MKPMLKDFSNLLLVVLCDYVLGEAEYLLLREPGHVALSNDTVYVDFQYFDGANGTLRNVSVLLLEANTNQ      1 - 70
TVTTKYLLTNQSQGTLKFECFYFKEAGDYWFTMTPEATDNSTPFPWWEKSAFLKVEWPVFHVDLNRSAKA     71 - 140
AEGTFQVGLFTSQPLCPFPVDKPNIVVDVIFTNSLPEARRNSRQPLEIRTSKRTELAQGQWVEFGCAPLG    141 - 210
PEAYVTVVLKLLGRDSVITSTGPIDLAQKFGYKLVMVPELTCESGVEVTVLPPPCTFVQGVVTVFKEAPR    211 - 280
YPGKRTIHLAENSLPLGERRTIFNCTLFDMGKNKYCFDFGISSRSHFSAKEECMLIQRNTETWGLWQPWS    281 - 350
QCSATCGDGVRERRRVCLTSFPSSPVCPGMSLEASLCSLEECAAFQPSSPSPLQPQGPVKSNNIVTVTGI    351 - 420
SLCLFIIIATVLITLWRRFGRPAKCSTPARHNSIHSPSFRKNSDEENICELSEQRGSFSDGGDGPTGSPG    421 - 490
DTGIPLTYRRSGPVPPEDDASGSESFQSNAQKIIPPLFSYRLAQQQLKEMKKKGLTETTKVYHVSQSPLT    491 - 560
DTAIDAAPSAPLDLESPEEAAANKFRIKSPFPEQPAVSAGERPPSRLDLNVTQASCAISPSQTLIRKSQA    561 - 630
RHVGSRGGPSERSHARNAHFRRTASFHEARQARPFRERSMSTLTPRQAPAYSSRTRTCEQAEDRFRPQSR    631 - 700
GAHLFPEKLEHFQEASGTRGPLNPLPKSYTLGQPLRKPDLGDHQAGLVAGIERTEPHRARRGPSPSHKSV    701 - 770
SRKQSSPISPKDNYQRVSSLSPSQCRKDKCQSFPTHPEFAFYDNTSFGLTEAEQRMLDLPGYFGSNEEDE    771 - 840
TTSTLSVEKLVI                                                              841 - 852
//

Text Mined References (11)

PMID Year Title
22664866 2012 Genome-wide screening for methylation-silenced genes in colorectal cancer.
18403638 2008 Monochromosome transfer and microarray analysis identify a critical tumor-suppressive region mapping to chromosome 13q14 and THSD1 in esophageal carcinoma.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17047544 2006 Immunolocalization of thrombospondin in the human and sand rat intervertebral disc.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15371459 2004 Thrombospondin induces RhoA inactivation through FAK-dependent signaling to stimulate focal adhesion disassembly.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...