Property Summary

NCBI Gene PubMed Count 43
Grant Count 44
R01 Count 32
Funding $4,632,033.06
PubMed Score 65.90
PubTator Score 47.25

Knowledge Summary

Patent (1,115)

Expression

Gene RIF (21)

PMID Text
26016905 mutations cause a gainoffunction of KV4.3/KChIP2encoded channels by increasing membrane protein expression and slowing channel inactivation.
24096004 A novel KCNQ1-G229D mutation identified in a juvenile-onset AF patient altered the IKs activity and kinetics, thereby increasing the arrhythmogenicity to AF.
21422811 The "structurally minimal" isoform KChIP2d modulates recovery of K(v)4.3 N-terminal deletion mutant Delta2-39.
20709747 KChIP2 differentially regulates total and cell surface Kv4.2 protein expression and Kv4 current densities.
20649599 The I(to) activator NS5806 modified Kv4.3/KChIP2 gating in several ways that inhibit current.
20498229 The cytoplasmic accessory subunit KChIP2 also assembles with Kv4.2 to increase peak current, shift V1/2 ~5mV, slow time to peak ~10%, slow inactivation ~100%, and speed recovery from inactivation ~250% without overshoot.
20354865 N-linked glycosylation of DPP10 plays an important role in modulating Kv4.3 channel/KCHIP2 complex activities.
19927631 Down-regulated atrial KChIP2 and Kv4.3 mRNA expressions in rheumatic heart disease patients with chronic atrial fibrillation might be one of the molecular bases responsible for the down-regulation of the I(to) current density of AF.
18957440 KChIP4a, KChIP2x, and KChIP3x comprise a novel class of KChIP isoforms characterized by an unusual transmembrane domain at their N termini that modulates Kv4 channel gating and trafficking.
18501111 KChIP2c and KCNE2 simultaneously participate in recapitulation of the electrophysiological properties of transient outward current in cardiac myocytes
More...

AA Sequence

MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPR      1 - 70
LLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGD     71 - 140
SSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYD    141 - 210
MMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI              211 - 270
//

Text Mined References (44)

PMID Year Title
26016905 2015 Two novel Brugada syndrome-associated mutations increase KV4.3 membrane expression and function.
24096004 2014 A novel KCNQ1 missense mutation identified in a patient with juvenile-onset atrial fibrillation causes constitutively open IKs channels.
21493962 2011 KCNE5 (KCNE1L) variants are novel modulators of Brugada syndrome and idiopathic ventricular fibrillation.
21422811 The "structurally minimal" isoform KChIP2d modulates recovery of K(v)4.3 N-terminal deletion mutant ?2-39.
21349352 2011 Transient outward current (I(to)) gain-of-function mutations in the KCND3-encoded Kv4.3 potassium channel and Brugada syndrome.
20709747 2010 Co-assembly of Kv4 {alpha} subunits with K+ channel-interacting protein 2 stabilizes protein expression and promotes surface retention of channel complexes.
20649599 2010 Effect of the I(to) activator NS5806 on cloned K(V)4 channels depends on the accessory protein KChIP2.
20498229 2010 The membrane protein MiRP3 regulates Kv4.2 channels in a KChIP-dependent manner.
20354865 2010 Impaired glycosylation blocks DPP10 cell surface expression and alters the electrophysiology of Ito channel complex.
19927631 2009 [Atrial myocytes KChIP2 mRNA expression in rheumatic heart disease patients with atrial fibrillation].
More...