Property Summary

NCBI Gene PubMed Count 44
PubMed Score 71.60
PubTator Score 47.25

Knowledge Summary

Patent (1,115)

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.900 4.9e-04
atypical teratoid/rhabdoid tumor -1.100 1.4e-02
breast carcinoma -1.700 2.5e-03
ductal carcinoma in situ -2.800 9.5e-04
ependymoma -1.200 9.3e-07
fibroadenoma -2.300 2.6e-02
glioblastoma -1.300 1.2e-05
invasive ductal carcinoma -2.800 8.9e-03
non diabetic and post-ischemic heart fai... -1.300 4.5e-03
oligodendroglioma 2.300 7.3e-04
Pick disease -1.300 3.8e-05
sonic hedgehog group medulloblastoma -1.100 1.7e-02
type II diabetes mellitus and post-ische... -1.900 2.1e-02

Protein-protein Interaction (3)

Gene RIF (22)

AA Sequence

MRGQGRKESLSDSRDLDGSYDQLTGHPPGPTKKALKQRFLKLLPCCGPQALPSVSETLAAPASLRPHRPR      1 - 70
LLDPDSVDDEFELSTVCHRPEGLEQLQEQTKFTRKELQVLYRGFKNECPSGIVNEENFKQIYSQFFPQGD     71 - 140
SSTYATFLFNAFDTNHDGSVSFEDFVAGLSVILRGTVDDRLNWAFNLYDLNKDGCITKEEMLDIMKSIYD    141 - 210
MMGKYTYPALREEAPREHVESFFQKMDRNKDGVVTIEEFIESCQKDENIMRSMQLFDNVI              211 - 270
//

Text Mined References (45)

PMID Year Title