Tbio | CREB/ATF bZIP transcription factor |
Strongly activates transcription when bound to HCFC1. Suppresses the expression of HSV proteins in cells infected with the virus in a HCFC1-dependent manner. Also suppresses the HCFC1-dependent transcriptional activation by CREB3 and reduces the amount of CREB3 in the cell. Able to down-regulate expression of some cellular genes in CREBZF-expressing cells.
Comments
Disease | Target Count | P-value |
---|---|---|
lung adenocarcinoma | 2714 | 1.76263144039627E-7 |
Pick disease | 1893 | 8.7790921239538E-7 |
ovarian cancer | 8492 | 7.92729196073793E-6 |
glioblastoma | 5572 | 1.98633051050527E-4 |
osteosarcoma | 7933 | 2.12879966138644E-4 |
medulloblastoma, large-cell | 6234 | 2.27869032145711E-4 |
gastric cancer | 436 | 4.42835059002882E-4 |
atypical teratoid / rhabdoid tumor | 4369 | 0.00118664746934729 |
lung cancer | 4473 | 0.00128011340336063 |
pediatric high grade glioma | 2712 | 0.0014927664977441 |
intraductal papillary-mucinous neoplasm (IPMN) | 3289 | 0.00274246976100763 |
sonic hedgehog group medulloblastoma | 1482 | 0.00351722158282396 |
progressive supranuclear palsy | 674 | 0.00611675135205434 |
Disease | log2 FC | p |
---|---|---|
gastric cancer | 1.200 | 0.000 |
osteosarcoma | -1.799 | 0.000 |
sonic hedgehog group medulloblastoma | 1.600 | 0.004 |
atypical teratoid / rhabdoid tumor | -1.500 | 0.001 |
glioblastoma | -1.800 | 0.000 |
medulloblastoma, large-cell | -1.600 | 0.000 |
intraductal papillary-mucinous neoplasm ... | 1.200 | 0.003 |
lung cancer | 1.200 | 0.001 |
pediatric high grade glioma | -1.300 | 0.001 |
lung adenocarcinoma | 1.514 | 0.000 |
Pick disease | -2.500 | 0.000 |
progressive supranuclear palsy | -2.200 | 0.006 |
ovarian cancer | -1.800 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Pig | OMA EggNOG |
Opossum | OMA EggNOG Inparanoid |
PMID | Text |
---|---|
24265317 | Results indicate that Ursodeoxycholic acid (UDCA) activates SMILE gene expression, which leads to repression of liver X receptor alpha (LXRalpha)-mediated hepatic lipogenic enzyme gene expression. |
24200963 | Zhangfei/CREBZF stabilizes p53 and co-localizes with it in cellular nuclei; the bLZip domain of Zhangfei is required for its profound effects on cell growth and interaction with p53. |
24155933 | Zhangfei had a suppressive effect on most unfolded protein response genes. |
22983008 | The transcription factor CREBZF is a novel positive regulator of p53. |
22798206 | Our objective was to determine the molecular mechanisms by which Zhangfei influences medulloblastoma cell lines |
22707059 | CREBZF, a novel Smad8-binding protein. |
22134986 | a microarray study of SMILE knock-down and PMA activation in HeLa cells was compared to earlier analysis based on microarray data of kidney allograft tolerance and rejection to determine possible new genes and gene networks involved in kidney transplantation |
21994947 | the curcumin/LKB1/AMPK/SMILE/PGC1alpha pathway differentially regulates ER stress-mediated gene transcription |
21603654 | SMILE is involved in the endoplasmic reticulum stress response, by modulating proteasome activity and XBP-1 transcript expression. This function of SMILE may influence immune cell behavior in the context of transplantation. |
19690166 | SMILE is a novel corepressor of ERRgamma, and SIRT1 has a role as a novel repressive mechanism for SMILE and ERRgamma inverse agonist |
More... |
MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSR 1 - 70 GGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSG 71 - 140 GLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSP 141 - 210 RKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARL 211 - 280 LSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASS 281 - 350 SLKM 351 - 354 //
PMID | Year | Title |
---|---|---|
25416956 | 2014 | A proteome-scale map of the human interactome network. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
24265317 | 2014 | Ursodeoxycholic acid inhibits liver X receptor ?-mediated hepatic lipogenesis via induction of the nuclear corepressor SMILE. |
24200963 | 2014 | Effects of cyclic AMP response element binding protein-Zhangfei (CREBZF) on the unfolded protein response and cell growth are exerted through the tumor suppressor p53. |
24155933 | 2013 | Zhangfei/CREB-ZF - a potential regulator of the unfolded protein response. |
22983008 | 2012 | The transcription factor CREBZF is a novel positive regulator of p53. |
22798206 | 2012 | Mechanism for the induction of cell death in ONS-76 medulloblastoma cells by Zhangfei/CREB-ZF. |
22707059 | 2012 | CREBZF, a novel Smad8-binding protein. |
22134986 | 2012 | SMILE silencing and PMA activation gene networks in HeLa cells: comparison with kidney transplantation gene networks. |
21994947 | 2011 | Curcumin differentially regulates endoplasmic reticulum stress through transcriptional corepressor SMILE (small heterodimer partner-interacting leucine zipper protein)-mediated inhibition of CREBH (cAMP responsive element-binding protein H). |
More... |