Property Summary

NCBI Gene PubMed Count 25
PubMed Score 10.81
PubTator Score 21.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
gastric cancer 1.200 0.000
osteosarcoma -1.799 0.000
sonic hedgehog group medulloblastoma 1.600 0.004
atypical teratoid / rhabdoid tumor -1.500 0.001
glioblastoma -1.800 0.000
medulloblastoma, large-cell -1.600 0.000
intraductal papillary-mucinous neoplasm ... 1.200 0.003
lung cancer 1.200 0.001
pediatric high grade glioma -1.300 0.001
lung adenocarcinoma 1.514 0.000
Pick disease -2.500 0.000
progressive supranuclear palsy -2.200 0.006
ovarian cancer -1.800 0.000

Gene RIF (17)

PMID Text
24265317 Results indicate that Ursodeoxycholic acid (UDCA) activates SMILE gene expression, which leads to repression of liver X receptor alpha (LXRalpha)-mediated hepatic lipogenic enzyme gene expression.
24200963 Zhangfei/CREBZF stabilizes p53 and co-localizes with it in cellular nuclei; the bLZip domain of Zhangfei is required for its profound effects on cell growth and interaction with p53.
24155933 Zhangfei had a suppressive effect on most unfolded protein response genes.
22983008 The transcription factor CREBZF is a novel positive regulator of p53.
22798206 Our objective was to determine the molecular mechanisms by which Zhangfei influences medulloblastoma cell lines
22707059 CREBZF, a novel Smad8-binding protein.
22134986 a microarray study of SMILE knock-down and PMA activation in HeLa cells was compared to earlier analysis based on microarray data of kidney allograft tolerance and rejection to determine possible new genes and gene networks involved in kidney transplantation
21994947 the curcumin/LKB1/AMPK/SMILE/PGC1alpha pathway differentially regulates ER stress-mediated gene transcription
21603654 SMILE is involved in the endoplasmic reticulum stress response, by modulating proteasome activity and XBP-1 transcript expression. This function of SMILE may influence immune cell behavior in the context of transplantation.
19690166 SMILE is a novel corepressor of ERRgamma, and SIRT1 has a role as a novel repressive mechanism for SMILE and ERRgamma inverse agonist
More...

AA Sequence

MRHSLTKLLAASGSNSPTRSESPEPAATCSLPSDLTRAAAGEEETAAAGSPGRKQQFGDEGELEAGRGSR      1 - 70
GGVAVRAPSPEEMEEEAIASLPGEETEDMDFLSGLELADLLDPRQPDWHLDPGLSSPGPLSSSGGGSDSG     71 - 140
GLWRGDDDDEAAAAEMQRFSDLLQRLLNGIGGCSSSSDSGSAEKRRRKSPGGGGGGGSGNDNNQAATKSP    141 - 210
RKAAAAAARLNRLKKKEYVMGLESRVRGLAAENQELRAENRELGKRVQALQEESRYLRAVLANETGLARL    211 - 280
LSRLSGVGLRLTTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASS    281 - 350
SLKM                                                                      351 - 354
//

Text Mined References (28)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24265317 2014 Ursodeoxycholic acid inhibits liver X receptor ?-mediated hepatic lipogenesis via induction of the nuclear corepressor SMILE.
24200963 2014 Effects of cyclic AMP response element binding protein-Zhangfei (CREBZF) on the unfolded protein response and cell growth are exerted through the tumor suppressor p53.
24155933 2013 Zhangfei/CREB-ZF - a potential regulator of the unfolded protein response.
22983008 2012 The transcription factor CREBZF is a novel positive regulator of p53.
22798206 2012 Mechanism for the induction of cell death in ONS-76 medulloblastoma cells by Zhangfei/CREB-ZF.
22707059 2012 CREBZF, a novel Smad8-binding protein.
22134986 2012 SMILE silencing and PMA activation gene networks in HeLa cells: comparison with kidney transplantation gene networks.
21994947 2011 Curcumin differentially regulates endoplasmic reticulum stress through transcriptional corepressor SMILE (small heterodimer partner-interacting leucine zipper protein)-mediated inhibition of CREBH (cAMP responsive element-binding protein H).
More...