Property Summary

NCBI Gene PubMed Count 17
Grant Count 4
R01 Count 4
Funding $688,458
PubMed Score 36.04
PubTator Score 9.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Synonym

Accession Q9NS28 B2RD23 RGS18
Symbols RGS13

Gene

PANTHER Protein Class (2)

PDB

2DLV   2JM5   2OWI  

Gene RIF (7)

PMID Text
22234696 These findings indicate cross-talk between platelet activation and inhibition pathways at the level of RGS18 and Gq.
22210881 Data show that that SPL/RGS/SHP1 complexes are present in resting platelets where constitutive phosphorylation of SPL(Y398) creates an atypical binding site for SHP-1.
20627871 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
16484797 gene mapped to chromosome 1.
11955952 molecular cloning and characterization of RGS18 as a regulator of G protein signalling in human platelets

AA Sequence

METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLA      1 - 70
KETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYE     71 - 140
KFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPT    141 - 210
NLRRRSRSFTCNEFQDVQSDVAIWL                                                 211 - 235
//

Text Mined References (18)

PMID Year Title
22234696 2012 Regulator of G-protein signaling 18 integrates activating and inhibitory signaling in platelets.
22210881 2012 A newly identified complex of spinophilin and the tyrosine phosphatase, SHP-1, modulates platelet activation by regulating G protein-dependent signaling.
20627871 2010 Genetic variations in regulator of G-protein signaling genes as susceptibility loci for second primary tumor/recurrence in head and neck squamous cell carcinoma.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16484797 2006 Assignment of UCK2, ATF3 and RGS18 from human chromosome 1 to porcine chromosomes 4, 9 and 10 with somatic and radiation hybrid panels.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14992813 2004 Selective expression of regulators of G-protein signaling (RGS) in the human central nervous system.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...