Property Summary

NCBI Gene PubMed Count 18
PubMed Score 35.81
PubTator Score 9.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Astrocytoma, Pilocytic 1.900 9.7e-07
chronic lymphosyte leukemia -1.100 8.7e-07
gastric cancer 1.300 1.7e-02
hepatocellular carcinoma 1.700 2.3e-05
interstitial cystitis 1.700 2.9e-03
intraductal papillary-mucinous carcinoma... -1.200 1.5e-02
lung adenocarcinoma -1.800 1.8e-10
lung carcinoma -1.300 6.3e-13
mucosa-associated lymphoid tissue lympho... 1.105 1.8e-02
non-small cell lung cancer -1.728 1.3e-18
osteosarcoma -3.228 3.7e-03
ovarian cancer -2.100 2.4e-09
pancreatic cancer 1.800 1.7e-03
pancreatic carcinoma 1.800 1.7e-03
pediatric high grade glioma 1.100 9.4e-03
spina bifida -1.062 4.9e-02
ulcerative colitis 1.700 4.0e-04

Synonym

Accession Q9NS28 B2RD23 RGS18
Symbols RGS13

Gene

PANTHER Protein Class (2)

PDB

2DLV   2JM5   2OWI  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (7)

AA Sequence

METTLLFFSQINMCESKEKTFFKLIHGSGKEETSKEAKIRAKEKRNRLSLLVQKPEFHEDTRSSRSGHLA      1 - 70
KETRVSPEEAVKWGESFDKLLSHRDGLEAFTRFLKTEFSEENIEFWIACEDFKKSKGPQQIHLKAKAIYE     71 - 140
KFIQTDAPKEVNLDFHTKEVITNSITQPTLHSFDAAQSRVYQLMEQDSYTRFLKSDIYLDLMEGRPQRPT    141 - 210
NLRRRSRSFTCNEFQDVQSDVAIWL                                                 211 - 235
//

Text Mined References (19)

PMID Year Title