Property Summary

NCBI Gene PubMed Count 12
PubMed Score 22.57
PubTator Score 2.37

Knowledge Summary

Patent

No data available

Gene RIF (1)

PMID Text
20073942 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MDKQSSAGGVKRSVPCDSNEANEMMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNFKRTSPEELLND      1 - 70
HARENRINPLQMEEEEFMEIMVEIPAK                                                71 - 97
//

Text Mined References (15)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20073942 2010 SPANX gene variation in fertile and infertile males.
17373721 2007 Mutational analysis of SPANX genes in families with X-linked prostate cancer.
17012309 2006 Hominoid-specific SPANXA/D genes demonstrate differential expression in individuals and protein localization to a distinct nuclear envelope domain during spermatid morphogenesis.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
16251457 2005 Dynamic structure of the SPANX gene cluster mapped to the prostate cancer susceptibility locus HPCX at Xq27.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14973187 2004 The SPANX gene family of cancer/testis-specific antigens: rapid evolution and amplification in African great apes and hominids.
14734458 2004 Genomic organization, incidence, and localization of the SPAN-x family of cancer-testis antigens in melanoma tumors and cell lines.
12758128 2003 The human SPANX multigene family: genomic organization, alignment and expression in male germ cells and tumor cell lines.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11133693 2001 Differential nuclear localization of the cancer/testis-associated protein, SPAN-X/CTp11, in transfected cells and in 50% of human spermatozoa.
10906052 2000 Spermatid-specific expression of the novel X-linked gene product SPAN-X localized to the nucleus of human spermatozoa.