Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 9.35

Knowledge Summary

Patent

No data available

Gene RIF (8)

AA Sequence

MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSP      1 - 70
EELLNDHARENRINPDQMEEEEFIEITTERPKK                                          71 - 103
//

Text Mined References (18)

PMID Year Title