Property Summary

NCBI Gene PubMed Count 18
PubMed Score 0.00
PubTator Score 9.35

Knowledge Summary

Patent

No data available

Gene RIF (8)

PMID Text
25229454 Epigenetic mechanisms underlying the dynamic expression of cancer-testis genes, PAGE2, -2B and SPANX-B, during mesenchymal-to-epithelial transition
20073942 Copy number variation of the entire gene cluster containing all four SPANXA-E genes and with SPANXB, found exclusively in maturing sperm. Average CNV patterns did not differ between fertile and infertile men.
20073942 Observational study of gene-disease association. (HuGE Navigator)
19417550 SPANX-B (Xq27 region) gene dosage analysis in Down's syndrome subjects with undescended testes
18626316 genetic variability of SPANX-B and SPANX-C in a sample of Sicilian male population including patients with melanoma of the skin and controls; Sixteen and 13 genetic classes were detected for SPANX-B and SPANX-C genes, respectively
18626316 Observational study of gene-disease association. (HuGE Navigator)
17342728 Human VCX/Y, SPANX, and CSAG2 gene families together with the murine SPANX gene and the CYPT family may share a common ancestor.
12393489 correlation between SPAN-Xb gene expression and B-cell immune responses in myeloma and other hematologic malignancies

AA Sequence

MGQQSSVRRLKRSVPCESNEANEANEANKTMPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSP      1 - 70
EELLNDHARENRINPDQMEEEEFIEITTERPKK                                          71 - 103
//

Text Mined References (18)

PMID Year Title
25229454 2014 Epigenetic mechanisms underlying the dynamic expression of cancer-testis genes, PAGE2, -2B and SPANX-B, during mesenchymal-to-epithelial transition.
21630459 2011 Proteomic characterization of the human sperm nucleus.
20073942 2010 SPANX gene variation in fertile and infertile males.
19417550 2009 SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in Down's syndrome subjects with undescended testes.
18626316 2008 SPANX-B and SPANX-C (Xq27 region) gene dosage analysis in Sicilian patients with melanoma.
17342728 2008 A shared promoter region suggests a common ancestor for the human VCX/Y, SPANX, and CSAG gene families and the murine CYPT family.
17012309 2006 Hominoid-specific SPANXA/D genes demonstrate differential expression in individuals and protein localization to a distinct nuclear envelope domain during spermatid morphogenesis.
16390498 2006 Expression of SpanX proteins in normal testes and in testicular germ cell tumours.
16251457 2005 Dynamic structure of the SPANX gene cluster mapped to the prostate cancer susceptibility locus HPCX at Xq27.
15772651 2005 The DNA sequence of the human X chromosome.
More...