Property Summary

NCBI Gene PubMed Count 373
Grant Count 89
R01 Count 49
Funding $6,297,239.69
PubMed Score 621.27
PubTator Score 701.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
ovarian cancer 1.100 0.000

Synonym

Accession Q9NS23 B7ZLL1 O14571 O60539 O60710 Q0VGC6 Q5TZT2 Q9HB04 Q9HB18 Q9NS22 Q9UND4 Q9UND5
Symbols 123F2
RDA32
NORE2A
RASSF1A
REH3P21

Gene

PANTHER Protein Class (2)

PDB

2KZU  

Gene RIF (357)

PMID Text
27078152 Results indicate that hypermethylation of tumor suppressor protein RASSF1A and docking protein 1 (DOK1) contributes to hepatocarcinogenesis and is associated to clinicopathological characteristics.
26759237 RASSF1 acts to restrict EMT and invasion by indirectly controlling YAP nuclear shuttling.
26754001 Different genetic mechanisms seem to contribute to RASSF1 deregulation in this setting, but RASSF1 methylation does not seem to substantially affect RASSF1 isoforms expression.
26648328 RASSF1C gene is not involved in Clear-cell renal cell carcinoma (ccRCC)progression and we propose that the measurements of RASSF1A mRNA levels in paired tumor-normal kidney tissue could serve as a new prognostic factor in ccRCC
26549256 Distinct RASSF1 isoforms have opposing functions, which provide a biomarker for YAP1 activation and explain correlations of RASSF1 methylation with advanced invasive disease in humans.
26482848 RASSF1A promotes the translocation of cytosolic PRMT5 to microtubules.PRMT5 co-localizes with RASSF1A on stabilized microtubules.
26392358 Data indicate tumor suppressors TP73, RASSF1A, MLH1 and BRCA1 as possible biomarkers to distinguish Pleomorphic invasive lobular cancer (pleomorphic ILC} from classic ILC and infiltrative ductal cancer (IDC).
26370119 Tumor-adjacent tissues showed higher methylation status of RASSF1A, HIN-1 and MGMT promoters.
26320446 Interaction between HPV infection and RASSF1A promoter methylation is associated with the development of cervical cancers.
26269600 MOAP-1 is a tumor suppressor protein linked to the RASSF1A protein
More...

AA Sequence

MSGEPELIELRELAPAGRAGKGRTRLERANALRIARGTACNPTRQLVPGRGHRFQPAGPATHTWCDLCGD      1 - 70
FIWGVVRKGLQCARLSADCKFTCHYRCRALVCLDCCGPRDLGWEPAVERDTNVDEPVEWETPDLSQAEIE     71 - 140
QKIKEYNAQINSNLFMSLNKDGSYTGFIKVQLKLVRPVSVPSSKKPPSLQDARRGPGRGTSVRRRTSFYL    141 - 210
PKDAVKHLHVLSRTRAREVIEALLRKFLVVDDPRKFALFERAERHGQVYLRKLLDDEQPLRLRLLAGPSD    211 - 280
KALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQILQKYSYCRQKIQEALHACPLG          281 - 344
//

Text Mined References (377)

PMID Year Title
27078152 2016 RASSF1A and DOK1 Promoter Methylation Levels in Hepatocellular Carcinoma, Cirrhotic and Non-Cirrhotic Liver, and Correlation with Liver Cancer in Brazilian Patients.
26759237 2016 RASSF1A Suppresses the Invasion and Metastatic Potential of Human Non-Small Cell Lung Cancer Cells by Inhibiting YAP Activation through the GEF-H1/RhoB Pathway.
26754001 2016 RASSF1 tumor suppressor gene in pancreatic ductal adenocarcinoma: correlation of expression, chromosomal status and epigenetic changes.
26648328 2016 Decreased expression of RASSF1A tumor suppressor gene is associated with worse prognosis in clear cell renal cell carcinoma.
26549256 2015 Alternate RASSF1 Transcripts Control SRC Activity, E-Cadherin Contacts, and YAP-Mediated Invasion.
26482848 2015 Identification of protein arginine N-methyltransferase 5 (PRMT5) as a novel interacting protein with the tumor suppressor protein RASSF1A.
26392358 2015 Methylation biomarkers for pleomorphic lobular breast cancer - a short report.
26370119 2015 Applicability of HIN-1, MGMT and RASSF1A promoter methylation as biomarkers for detecting field cancerization in breast cancer.
26320446 2015 Association between RASSF1A Promoter Hypermethylation and Oncogenic HPV Infection Status in Invasive Cervical Cancer: a Meta-analysis.
26269600 2015 Modulator of apoptosis 1 (MOAP-1) is a tumor suppressor protein linked to the RASSF1A protein.
More...