Property Summary

NCBI Gene PubMed Count 50
Grant Count 17
R01 Count 12
Funding $1,009,935.05
PubMed Score 80.10
PubTator Score 58.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.400 0.003
ependymoma -2.600 0.005
oligodendroglioma -2.000 0.010
psoriasis 1.200 0.005
medulloblastoma -1.700 0.000
atypical teratoid / rhabdoid tumor -1.100 0.002
medulloblastoma, large-cell -1.200 0.003
intraductal papillary-mucinous neoplasm ... 1.200 0.006
lung cancer 1.700 0.011
Breast cancer 1.300 0.000

Gene RIF (20)

PMID Text
25735211 Grx2 and Trx1 contribute significantly to neuronal integrity and could be clinically relevant in neuronal damage following perinatal asphyxia and other neuronal disorders.
24295294 The Grx2 system could help to keep Trx2/1 reduced during an oxidative stress, thereby contributing to the anti-apoptotic signaling.
22139372 Grx2 thiol redox regulation is essential for vertebrate embryonic development
21735102 These results suggest that Grx2a plays proliferative and anti-apoptotic roles under serum deprivation.
21437321 Exchange of [2Fe-2S] centers between glutaredoxin 2 and the cluster scaffold protein ISU, supports a direct link for glutaredoxin 2 and glutathione involvement in ISU promoted Fe-S cluster biosynthesis.
20929858 Both thioredoxin 2 and glutaredoxin 2 contribute to the reduction of the mitochondrial 2-Cys peroxiredoxin Prx3.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20547138 Studies indicate that the mechanism of Grx2 protection against H(2)O(2)-induced apoptosis is likely associated with its ability to preserve complex I.
19292455 cluster signal of Grx2 is stable at positive potentials up to 0.5 V but that cluster destruction occurs readily when oxidative pulses in excess of this value are applied
18816065 Grx1 and Grx2 exhibit key catalytic similarities, including selectivity for protein-SSG substrates and a nucleophilic, double-displacement, monothiol mechanism exhibiting a strong commitment to catalysis.
More...

AA Sequence

MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVV      1 - 70
IFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRL     71 - 140
HKEGKLLPLVHQCYLKKSKRKEFQ                                                  141 - 164
//

Text Mined References (51)

PMID Year Title
25735211 2015 Thioredoxin 1 and glutaredoxin 2 contribute to maintain the phenotype and integrity of neurons following perinatal asphyxia.
24295294 2014 Glutaredoxin 2 reduces both thioredoxin 2 and thioredoxin 1 and protects cells from apoptosis induced by auranofin and 4-hydroxynonenal.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22139372 2011 Vertebrate-specific glutaredoxin is essential for brain development.
21735102 2012 Glutaredoxin 2a, a mitochondrial isoform, plays a protective role in a human cell line under serum deprivation.
21586322 2011 Segment-specific overexpression of redoxins after renal ischemia and reperfusion: protective roles of glutaredoxin 2, peroxiredoxin 3, and peroxiredoxin 6.
21437321 2011 Mechanism of glutaredoxin-ISU [2Fe-2S] cluster exchange.
21029046 2011 The crystal structure of human GLRX5: iron-sulfur cluster co-ordination, tetrameric assembly and monomer activity.
20929858 2010 Both thioredoxin 2 and glutaredoxin 2 contribute to the reduction of the mitochondrial 2-Cys peroxiredoxin Prx3.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...