Property Summary

NCBI Gene PubMed Count 50
PubMed Score 85.49
PubTator Score 58.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
astrocytic glioma -2.400 3.4e-03
atypical teratoid / rhabdoid tumor -1.100 1.9e-03
Breast cancer 1.300 5.9e-16
ependymoma -2.600 5.3e-03
group 4 medulloblastoma -1.500 4.8e-04
intraductal papillary-mucinous neoplasm ... 1.200 6.3e-03
lung cancer 1.700 1.1e-02
medulloblastoma, large-cell -1.200 2.7e-03
oligodendroglioma -2.000 1.0e-02
psoriasis 1.200 5.5e-03

Gene RIF (20)

AA Sequence

MIWRRAALAGTRLVWSRSGSAGWLDRAAGAAGAAAAAASGMESNTSSSLENLATAPVNQIQETISDNCVV      1 - 70
IFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRL     71 - 140
HKEGKLLPLVHQCYLKKSKRKEFQ                                                  141 - 164
//

Text Mined References (51)

PMID Year Title