Property Summary

NCBI Gene PubMed Count 32
PubMed Score 1230.05
PubTator Score 18.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (19)

Disease log2 FC p
adult high grade glioma 1.300 2.5e-03
astrocytic glioma 1.800 1.4e-02
Astrocytoma, Pilocytic 2.100 9.3e-10
atypical teratoid / rhabdoid tumor 1.400 3.6e-04
autosomal dominant Emery-Dreifuss muscul... 1.010 1.9e-02
Chronic Lymphocytic Leukemia 1.150 4.5e-02
Common variable immunodeficiency -1.081 2.5e-02
cystic fibrosis 1.146 4.8e-04
ependymoma 2.800 2.7e-03
glioblastoma 1.300 6.5e-06
intraductal papillary-mucinous carcinoma... -1.200 1.4e-02
lung adenocarcinoma 1.407 4.9e-05
Multiple myeloma 1.727 9.1e-03
oligodendroglioma 2.300 3.6e-03
osteosarcoma 1.491 3.1e-02
ovarian cancer -1.500 7.7e-06
pancreatic cancer 1.700 9.0e-03
primary pancreatic ductal adenocarcinoma 1.673 3.9e-03
psoriasis 3.000 8.1e-06

 CSPA Cell Line (4)

Gene RIF (13)

AA Sequence

MPGPRGAAGGLAPEMRGAGAAGLLALLLLLLLLLLGLGGRVEGGPAGERGAGGGGALARERFKVVFAPVI      1 - 70
CKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNGGQCSSRNQCLCPPDFTGRFC     71 - 140
QVPAGGAGGGTGGSGPGLSRTGALSTGALPPLAPEGDSVASKHAIYAVQVIADPPGPGEGPPAQHAAFLV    141 - 210
PLGPGQISAEVQAPPPVVNVRVHHPPEASVQVHRIESSNAESAAPSQHLLPHPKPSHPRPPTQKPLGRCF    211 - 280
QDTLPKQPCGSNPLPGLTKQEDCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNS    281 - 350
THCQDINECAMPGVCRHGDCLNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLT    351 - 420
TRLTRQLCCCSVGKAWGARCQRCPTDGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSLFLHPDGPPKP    421 - 490
QQLPESPSQAPPPEDTEEERGVTTDSPVSEERSVQQSHPTATTTPARPYPELISRPSPPTMRWFLPDLPP    491 - 560
SRSAVEIAPTQVTETDECRLNQNICGHGECVPGPPDYSCHCNPGYRSHPQHRYCVDVNECEAEPCGPGRG    561 - 630
ICMNTGGSYNCHCNRGYRLHVGAGGRSCVDLNECAKPHLCGDGGFCINFPGHYKCNCYPGYRLKASRPPV    631 - 700
CEDIDECRDPSSCPDGKCENKPGSFKCIACQPGYRSQGGGACRDVNECAEGSPCSPGWCENLPGSFRCTC    701 - 770
AQGYAPAPDGRSCLDVDECEAGDVCDNGICSNTPGSFQCQCLSGYHLSRDRSHCEDIDECDFPAACIGGD    771 - 840
CINTNGSYRCLCPQGHRLVGGRKCQDIDECSQDPSLCLPHGACKNLQGSYVCVCDEGFTPTQDQHGCEEV    841 - 910
EQPHHKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHSLCPDGKGYTQD    911 - 980
NNIVNYGIPAHRDIDECMLFGSEICKEGKCVNTQPGYECYCKQGFYYDGNLLECVDVDECLDESNCRNGV    981 - 1050
CENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDECQDPAACRPGRCVNLPGSYRCECRPPWVPGPSGRD   1051 - 1120
CQLPESPAERAPERRDVCWSQRGEDGMCAGPLAGPALTFDDCCCRQGRGWGAQCRPCPPRGAGSHCPTSQ   1121 - 1190
SESNSFWDTSPLLLGKPPRDEDSSEEDSDECRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRE   1191 - 1260
LNQRGLLCKSERCVNTSGSFRCVCKAGFARSRPHGACVPQRRR                              1261 - 1303
//

Text Mined References (33)

PMID Year Title