Property Summary

NCBI Gene PubMed Count 47
PubMed Score 61.70
PubTator Score 45.96

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (39)

AA Sequence

MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSS      1 - 70
QHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGR     71 - 140
DQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGG    141 - 210
AGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYL    211 - 280
PRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQA    281 - 350
NKNEDTKVKLGNP                                                             351 - 363
//

Text Mined References (50)

PMID Year Title