Property Summary

NCBI Gene PubMed Count 42
Grant Count 42
R01 Count 18
Funding $11,844,195.34
PubMed Score 57.36
PubTator Score 45.96

Knowledge Summary

Patent

No data available

Expression

Gene RIF (34)

PMID Text
26125729 Polymorphisms in the C1GALT1 gene were associated with genetic susceptibility to Uyghur Immunoglobulin A (IgA) nephropathy.
26063800 Cosmc and T-synthase are transcriptionally regulated at a basal level by the specificity protein/Kruppel-like transcription factor family of members.
25762620 Overexpression of C1GALT1 enhanced breast cancer cell growth, migration, and invasion in vitro as well as tumor growth in vivo.
25089569 C1GALT1 promotes invasive phenotypes of hepatocellular carcinoma cells by modulating integrin beta1 glycosylation and activity.
24840470 Using qRT-PCR, sialyl-Tn expression was found to be associated with an increase in alpha2,6-sialyltransferase gene (ST6GALNAC1) and a decrease in core 1 synthase gene (C1GALT1) in LS174T cells.
24758762 C1GALT1 overexpression modifies O-glycans on FGFR2 and enhances its phosphorylation to promote the invasive behavior and cancer stem-like property in colon cancer cells.
24462875 Data indicate that cytotoxin associated gene A protein (CagA) promoted the underglycosylation of IgA1, which at least partly attributed to the downregulation of beta1,3-galactosyltransferase (C1GALT1) and its chaperone Cosmc.
24398680 Il-6 and Il-4 reduced galactosylation of the O-glycan substrate directly via decreased expression of the galactosyltransferase C1GalT1 and, indirectly, via increased expression of the sialyltransferase ST6GalNAc-II
23832667 High C1GALT1 enhances proliferation of hepatocellular carcinoma cells via modulating MET glycosylation and dimerization.
23624553 Variations in the C1GALT1 gene were found to be associated with Henoch-Schonlein purpura risk.
More...

AA Sequence

MASKSWLNFLTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSS      1 - 70
QHKDENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFPAVGLKTKEGR     71 - 140
DQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVKQGYMSGG    141 - 210
AGYVLSKEALKRFVDAFKTDKCTHSSSIEDLALGRCMEIMNVEAGDSRDTIGKETFHPFVPEHHLIKGYL    211 - 280
PRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHLRPYGYLYRYQPTLPERILKEISQA    281 - 350
NKNEDTKVKLGNP                                                             351 - 363
//

Text Mined References (45)

PMID Year Title
26125729 2015 Association between C1GALT1 variants and genetic susceptibility to IgA nephropathy in Uygur.
26063800 2015 Promoters of Human Cosmc and T-synthase Genes Are Similar in Structure, Yet Different in Epigenetic Regulation.
25762620 2015 Up-regulation of C1GALT1 promotes breast cancer cell growth through MUC1-C signaling pathway.
25089569 2014 C1GALT1 promotes invasive phenotypes of hepatocellular carcinoma cells by modulating integrin ?1 glycosylation and activity.
24840470 2014 Comprehensive glycomics comparison between colon cancer cell cultures and tumours: implications for biomarker studies.
24758762 2014 C1GALT1 overexpression promotes the invasive behavior of colon cancer cells through modifying O-glycosylation of FGFR2.
24556642 2014 Genome-wide association study of primary dentition pit-and-fissure and smooth surface caries.
24462875 2014 CagA, a major virulence factor of Helicobacter pylori, promotes the production and underglycosylation of IgA1 in DAKIKI cells.
24398680 2014 Cytokines alter IgA1 O-glycosylation by dysregulating C1GalT1 and ST6GalNAc-II enzymes.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
More...