Property Summary

NCBI Gene PubMed Count 26
PubMed Score 95.29
PubTator Score 78.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Compartment syndrome 11 3.824 1.9
Schimke immuno-osseous dysplasia 8 3.064 1.5

Expression

  Differential Expression (27)

Disease log2 FC p
adrenocortical carcinoma 2.107 8.2e-04
adult high grade glioma 1.500 1.9e-04
Astrocytoma, Pilocytic 1.200 9.5e-08
Atopic dermatitis 1.300 9.4e-06
atypical teratoid / rhabdoid tumor 2.100 1.7e-05
Breast cancer 3.000 2.9e-02
ductal carcinoma in situ 1.400 2.2e-02
Endometriosis 1.482 3.4e-02
ependymoma 1.500 2.5e-09
gastric cancer 1.100 1.3e-04
glioblastoma 1.100 1.7e-03
group 3 medulloblastoma 2.100 8.0e-04
intraductal papillary-mucinous carcinoma... 1.900 1.3e-04
intraductal papillary-mucinous neoplasm ... 1.800 3.0e-03
invasive ductal carcinoma 1.500 2.2e-02
lung cancer 3.400 4.5e-04
malignant mesothelioma 2.000 2.7e-07
medulloblastoma, large-cell 2.500 2.1e-04
nasopharyngeal carcinoma 1.800 1.6e-03
non primary Sjogren syndrome sicca -1.200 2.2e-02
non-small cell lung cancer 1.555 1.2e-17
oligodendroglioma 1.200 5.6e-06
ovarian cancer 1.200 3.5e-04
pancreatic cancer 1.100 6.8e-04
primitive neuroectodermal tumor 2.800 4.2e-05
psoriasis 1.100 1.4e-07
ulcerative colitis 1.100 2.6e-05

Protein-protein Interaction (1)

Gene RIF (11)

AA Sequence

MPAERPAGSGGSEAPAMVEQLDTAVITPAMLEEEEQLEAAGLERERKMLEKARMSWDRESTEIRYRRLQH      1 - 70
LLEKSNIYSKFLLTKMEQQQLEEQKKKEKLERKKESLKVKKGKNSIDASEEKPVMRKKRGREDESYNISE     71 - 140
VMSKEEILSVAKKNKKENEDENSSSTNLCVEDLQKNKDSNSIIKDRLSETVRQNTKFFFDPVRKCNGQPV    141 - 210
PFQQPKHFTGGVMRWYQVEGMEWLRMLWENGINGILADEMGLGKTVQCIATIALMIQRGVPGPFLVCGPL    211 - 280
STLPNWMAEFKRFTPDIPTMLYHGTQEERQKLVRNIYKRKGTLQIHPVVITSFEIAMRDRNALQHCYWKY    281 - 350
LIVDEGHRIKNMKCRLIRELKRFNADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSL    351 - 420
SETAEDIIAKEREQNVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQEIFYTAIVNRTIAN    421 - 490
MFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPVESEVNLKL    491 - 560
QNIMMLLRKCCNHPYLIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPELKKRGHKVLLFSQMTSMLDI    561 - 630
LMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNTDPEVFIFLVSTRAGGLGINLTAADTVIIYDSDWNPQS    631 - 700
DLQAQDRCHRIGQTKPVVVYRLVTANTIDQKIVERAAAKRKLEKLIIHKNHFKGGQSGLNLSKNFLDPKE    701 - 770
LMELLKSRDYEREIKGSREKVISDKDLELLLDRSDLIDQMNASGPIKEKMGIFKILENSEDSSPECLF      771 - 838
//

Text Mined References (33)

PMID Year Title