Property Summary

NCBI Gene PubMed Count 25
Grant Count 7
R01 Count 5
Funding $997,547.5
PubMed Score 89.73
PubTator Score 78.09

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26216346 Mutations in HELLS cause immunodeficiency-centromeric instability-facial anomalies syndrome type 4.
25351940 Mutations of HELLS gene is associated with stomach and colorectal cancers.
25338120 Upregulation of HELLS and UHRF1 is essential for the tumor phenotype. Also, these epigenetic regulators are important for the regulation of SYK.
22157815 just as E2F3, HELLS is overexpressed in human tumours including prostate cancer, indicating that either factor may contribute to the malignant progression of tumours
21453717 E2F1 plays a crucial role in transcriptional control of the human Lsh gene and the decrease of Lsh expression in senescent cells is related to the repression of E2F1
20400365 Data provide strong evidence that CEP55 and HELLS may be used in conjunction with FOXM1 as a biomarker set for early cancer detection and indicators of malignant conversion and progression.
19561196 Lsh overexpression delays cell senescence by silencing p16(INK4a) in human fibroblasts.
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
18948754 These results suggest differences in cellular consequences of hypomethylation mediated by PASG during development compared to that in somatic cells.
17967891 LSH serves as a recruiting factor for DNA methyltransferases and histone deacetylases to establish transcriptionally repressive chromatin which is perhaps further stabilized by DNA methylation at targeted loci

AA Sequence

MPAERPAGSGGSEAPAMVEQLDTAVITPAMLEEEEQLEAAGLERERKMLEKARMSWDRESTEIRYRRLQH      1 - 70
LLEKSNIYSKFLLTKMEQQQLEEQKKKEKLERKKESLKVKKGKNSIDASEEKPVMRKKRGREDESYNISE     71 - 140
VMSKEEILSVAKKNKKENEDENSSSTNLCVEDLQKNKDSNSIIKDRLSETVRQNTKFFFDPVRKCNGQPV    141 - 210
PFQQPKHFTGGVMRWYQVEGMEWLRMLWENGINGILADEMGLGKTVQCIATIALMIQRGVPGPFLVCGPL    211 - 280
STLPNWMAEFKRFTPDIPTMLYHGTQEERQKLVRNIYKRKGTLQIHPVVITSFEIAMRDRNALQHCYWKY    281 - 350
LIVDEGHRIKNMKCRLIRELKRFNADNKLLLTGTPLQNNLSELWSLLNFLLPDVFDDLKSFESWFDITSL    351 - 420
SETAEDIIAKEREQNVLHMLHQILTPFLLRRLKSDVALEVPPKREVVVYAPLSKKQEIFYTAIVNRTIAN    421 - 490
MFGSSEKETIELSPTGRPKRRTRKSINYSKIDDFPNELEKLISQIQPEVDRERAVVEVNIPVESEVNLKL    491 - 560
QNIMMLLRKCCNHPYLIEYPIDPVTQEFKIDEELVTNSGKFLILDRMLPELKKRGHKVLLFSQMTSMLDI    561 - 630
LMDYCHLRDFNFSRLDGSMSYSEREKNMHSFNTDPEVFIFLVSTRAGGLGINLTAADTVIIYDSDWNPQS    631 - 700
DLQAQDRCHRIGQTKPVVVYRLVTANTIDQKIVERAAAKRKLEKLIIHKNHFKGGQSGLNLSKNFLDPKE    701 - 770
LMELLKSRDYEREIKGSREKVISDKDLELLLDRSDLIDQMNASGPIKEKMGIFKILENSEDSSPECLF      771 - 838
//

Text Mined References (32)

PMID Year Title
26216346 2015 Mutations in CDCA7 and HELLS cause immunodeficiency-centromeric instability-facial anomalies syndrome.
25351940 2015 Mutation of HELLS, a chromatin remodeling gene, gastric and colorectal cancers.
25338120 2014 Chromatin remodelers HELLS and UHRF1 mediate the epigenetic deregulation of genes that drive retinoblastoma tumor progression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22946062 2012 The SNF2 family ATPase LSH promotes phosphorylation of H2AX and efficient repair of DNA double-strand breaks in mammalian cells.
22157815 2012 The SNF2-like helicase HELLS mediates E2F3-dependent transcription and cellular transformation.
21453717 2011 Transcriptional activation of the senescence regulator Lsh by E2F1.
21269460 2011 Initial characterization of the human central proteome.
21248752 2011 Exome sequencing identifies frequent mutation of the SWI/SNF complex gene PBRM1 in renal carcinoma.
20400365 2010 Downstream targets of FOXM1: CEP55 and HELLS are cancer progression markers of head and neck squamous cell carcinoma.
More...