Property Summary

NCBI Gene PubMed Count 16
PubMed Score 11.24
PubTator Score 7.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.000
psoriasis 1.400 0.005
osteosarcoma -2.000 0.000
glioblastoma -1.700 0.001
medulloblastoma -1.800 0.000
atypical teratoid / rhabdoid tumor -1.900 0.000
medulloblastoma, large-cell -2.300 0.000
primitive neuroectodermal tumor -1.600 0.000
tuberculosis 1.200 0.000
intraductal papillary-mucinous adenoma (... 1.400 0.005
intraductal papillary-mucinous neoplasm ... 1.700 0.010
adult high grade glioma -1.700 0.000
pilocytic astrocytoma -1.400 0.000
Pick disease 1.200 0.000
ovarian cancer 2.300 0.000

Synonym

Accession Q9NRZ7 D3DSL2 Q3ZCU2 Q6UWP6 Q6ZUC6 Q8N3Q7 Q9NRZ6
Symbols LPAAT3
LPAAT-GAMMA1

Gene

Gene RIF (5)

PMID Text
21173190 enzymatic properties, tissue distribution, and subcellular localization of human AGPAT3 and AGPAT5
20537980 The data is consistent with a structural arrangement in which motif I is located in the cytoplasm and motif II is in the endoplasmic reticulum and Golgi lumen, suggesting a different model for AGPAT3/LPAAT3's enzymatic mechanism.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19635840 Results report the identification of an integral membrane lysophosphatidic acid-specific acyltransferase, LPAAT3, which regulates Golgi membrane tubule formation, trafficking, and structure by altering phospholipids and lysophospholipids.
16620771 Of the two well conserved acyltransferase motifs, NHX(4)D is present in AGPAT8, whereas arginine in the EGTR motif is substituted by aspartate.

AA Sequence

MGLLAFLKTQFVLHLLVGFVFVVSGLVINFVQLCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSC      1 - 70
TECTLFTDQATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYFLE     71 - 140
IVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLPVLKYHLLPRTKG    141 - 210
FTTAVKCLRGTVAAVYDVTLNFRGNKNPSLLGILYGKKYEADMCVRRFPLEDIPLDEKEAAQWLHKLYQE    211 - 280
KDALQEIYNQKGMFPGEQFKPARRPWTLLNFLSWATILLSPLFSFVLGVFASGSPLLILTFLGFVGAASF    281 - 350
GVRRLIGVTEIEKGSSYGNQEFKKKE                                                351 - 376
//

Text Mined References (18)

PMID Year Title
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
21173190 2011 Enzymatic activities of the human AGPAT isoform 3 and isoform 5: localization of AGPAT5 to mitochondria.
20537980 2010 Membrane topology of human AGPAT3 (LPAAT3).
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19946888 2010 Defining the membrane proteome of NK cells.
19635840 2009 Lysophosphatidic acid acyltransferase 3 regulates Golgi complex structure and function.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
16620771 2006 Functional characterization of human 1-acylglycerol-3-phosphate acyltransferase isoform 8: cloning, tissue distribution, gene structure, and enzymatic activity.
More...