Property Summary

NCBI Gene PubMed Count 5
PubMed Score 1.13
PubTator Score 1.79

Knowledge Summary

Patent

No data available

Expression

Gene

PANTHER Protein Class (1)

Gene RIF (2)

PMID Text
24648509 hPLSCR1 and PRD-hPLSCR2 showed Ca(2+)-dependent aggregation and scrambling activity
19540310 Results show that binding affinities of the peptides are in the order hPLSCR1>hPLSCR3>hPLSCR2>hPLSCR4 for Ca2+ and in the order hPLSCR1>hPLSCR2>hPLSCR3>hPLSCR4 for Mg2+.

AA Sequence

MRSWNSLFCLNSSRPPGHIVYPKHQAGHTGKQADHLGSQAFYPGRQHDYLVPPAGTAGIPVQNQPGRPEG      1 - 70
VPWMPAPPPPLNCPPGLEYLSQIDMILIHQQIELLEVLFSFESSNMYEIKNSFGQRIYFAAEDTNFCIRN     71 - 140
CCGRSRPFTLRITDNVGREVITLERPLRCNCCCCPCCLQEIEIQAPPGVPVGYVTQTWHPCLTKFTIKNQ    141 - 210
KREDVLKISGPCIVCSCIAGVDFEITSLDEQIVVGRISKHWSGFLREAFTDADNFGIQFPRDLDVKMKAV    211 - 280
MIGACFLIDYMFFERTR                                                         281 - 297
//

Text Mined References (7)

PMID Year Title
24648509 2014 N-terminal proline-rich domain is required for scrambling activity of human phospholipid scramblases.
19540310 2009 Calcium binding studies of peptides of human phospholipid scramblases 1 to 4 suggest that scramblases are new class of calcium binding proteins in the cell.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10930526 2000 Identification of three new members of the phospholipid scramblase gene family.