Property Summary

NCBI Gene PubMed Count 16
PubMed Score 10.26
PubTator Score 11.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count Z-score Confidence
Tongue squamous cell carcinoma 3 3.019 1.5

Expression

Gene RIF (8)

AA Sequence

MAGYLPPKGYAPSPPPPYPVTPGYPEPALHPGPGQAPVPAQVPAPAPGFALFPSPGPVALGSAAPFLPLP      1 - 70
GVPSGLEFLVQIDQILIHQKAERVETFLGWETCNRYELRSGAGQPLGQAAEESNCCARLCCGARRPLRVR     71 - 140
LADPGDREVLRLLRPLHCGCSCCPCGLQEMEVQAPPGTTIGHVLQTWHPFLPKFSIQDADRQTVLRVVGP    141 - 210
CWTCGCGTDTNFEVKTRDESRSVGRISKQWGGLVREALTDADDFGLQFPLDLDVRVKAVLLGATFLIDYM    211 - 280
FFEKRGGAGPSAVTS                                                           281 - 295
//

Text Mined References (18)

PMID Year Title