Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.40
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 9.8e-09
atypical teratoid/rhabdoid tumor 1.200 6.0e-08
ependymoma 1.200 9.0e-12
group 3 medulloblastoma 1.600 6.9e-06
ovarian cancer -1.400 3.0e-08
pancreatic ductal adenocarcinoma liver m... -1.126 3.2e-02
psoriasis -1.400 1.6e-04

Synonym

Accession Q9NRY5 B2R8D8 Q9H7E0
Symbols 133K02
C5orf3

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Function (1)

 Compartment GO Term (1)

AA Sequence

MSDKDDIETPLLTEAAPILEDGNCEPAKNSESVDQGAKPESKSEPVVSTRKRPETKPSSDLETSKVLPIQ      1 - 70
DNVSKDVPQTRWGYWGSWGKSILSSASATVATVGQGISNVIEKAETSLGIPGPSEISTEVKYVAGETNAK     71 - 140
ENENSSPVAGAFGVFSTISTAVQSTGKSVISGGLDALEFIGKKTMDVIAEGDPGFKRTKGLMNRNATLSQ    141 - 210
VLREAKEKEEIRTSNEVTVETDKKTHYGLLFDEFQGLSHLEALEMLSQESEIKVKSILNSLSGEELETLK    211 - 280
VELEQLKETFSLAEFCEEEEEEKKGDEDFTKDITELFSQLHVSSKPEKLARARNTAHEWIRKSLTKPLAE    281 - 350
NEEGEKQSEAENTEQVNKNSIEDIHAFAIRSLAELTACSIELFHKTAALVLHGRKQEVTAIERSQTLSQM    351 - 420
TIVLCKELSSLSKEFTTCLTTAGVKEMADVLNPLITAVFLEASNSASYIQDAFQLLLPVLEISLIENKIE    421 - 490
SHRHELQGQKPLLEH                                                           491 - 505
//

Text Mined References (12)

PMID Year Title