Property Summary

NCBI Gene PubMed Count 41
Grant Count 147
R01 Count 105
Funding $8,327,422.4
PubMed Score 71.19
PubTator Score 53.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.100 0.007
osteosarcoma -1.224 0.008
glioblastoma 1.300 0.001
medulloblastoma, large-cell -1.300 0.001
juvenile dermatomyositis 1.090 0.000
adult high grade glioma -1.300 0.000
group 4 medulloblastoma 1.200 0.014
ulcerative colitis -1.100 0.000
ovarian cancer -1.700 0.000

Synonym

Accession Q9NRY4 A7E2A4 Q14452 Q9C0E1
Symbols GRF-1
GRLF1
P190A
P190-A
p190RhoGAP
p190ARhoGAP

Gene

PANTHER Protein Class (2)

PDB

2K85   3C5H   3FK2  

Gene RIF (28)

PMID Text
25359885 these data demonstrate that a complex of p190RhoGAP-A and anillin modulates RhoA-GTP levels in the cytokinetic furrow to ensure progression of cytokinesis.
25185653 GRF-1 expression may modify osteosarcoma prognosis and may be a potential tumor therapeutic target.
25136583 ARHGAP35 rs1052667 polymorphism was an independent prognostic factor influencing the survival of osteosarcoma.
25025568 These results place Blk upstream of the p190RhoGAP-RhoA pathway in Galpha13-activated cells, overall representing an opposing signaling module during CXCL12-triggered invasion.
24465899 A ubiquitous binding partner of p190RhoGAP, p120RasGAP (RasGAP), is expressed in much lower levels in DKO4 cells compared to DLD1, and this expression is regulated by KRAS.
24403595 These data suggest that the interaction of human papillomavirus E7 with p190 dysregulates this GTPase activating protein and alters the actin cytoskeleton.
24043274 Overexpression of p190 mRNA associated with lung adenocarcinoma.
23552690 RhoA is down-regulated at cell-cell contacts via p190RhoGAP-B in response to tensional homeostasis.
23178654 These results suggest that folic acid might inhibit endothelial cell migration through inhibiting the RhoA activity mediated by activating the FR/cSrc/p190RhoGAP-signaling pathway.
22357615 role of the N-terminal region in signaling; Rnd1 and Rnd3 have a KERRA (Lys-Glu-Arg-Arg-Ala) sequence of amino acids in their N-terminus, which functions as the lipid raft-targeting determinant; the sequence mediates lipid raft targeting of p190 RhoGAP correlated with its activation
More...

AA Sequence

MMMARKQDVRIPTYNISVVGLSGTEKEKGQCGIGKSCLCNRFVRPSADEFHLDHTSVLSTSDFGGRVVNN      1 - 70
DHFLYWGEVSRSLEDCVECKMHIVEQTEFIDDQTFQPHRSTALQPYIKRAAATKLASAEKLMYFCTDQLG     71 - 140
LEQDFEQKQMPDGKLLVDGFLLGIDVSRGMNRNFDDQLKFVSNLYNQLAKTKKPIVVVLTKCDEGVERYI    141 - 210
RDAHTFALSKKNLQVVETSARSNVNVDLAFSTLVQLIDKSRGKTKIIPYFEALKQQSQQIATAKDKYEWL    211 - 280
VSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLFLQHIHRLKHEHIERRRKLYLAALPLAFEA    281 - 350
LIPNLDEIDHLSCIKAKKLLETKPEFLKWFVVLEETPWDATSHIDNMENERIPFDLMDTVPAEQLYEAHL    351 - 420
EKLRNERKRVEMRRAFKENLETSPFITPGKPWEEARSFIMNEDFYQWLEESVYMDIYGKHQKQIIDKAKE    421 - 490
EFQELLLEYSELFYELELDAKPSKEKMGVIQDVLGEEQRFKALQKLQAERDALILKHIHFVYHPTKETCP    491 - 560
SCPACVDAKIEHLISSRFIRPSDRNQKNSLSDPNIDRINLVILGKDGLARELANEIRALCTNDDKYVIDG    561 - 630
KMYELSLRPIEGNVRLPVNSFQTPTFQPHGCLCLYNSKESLSYVVESIEKSRESTLGRRDNHLVHLPLTL    631 - 700
ILVNKRGDTSGETLHSLIQQGQQIASKLQCVFLDPASAGIGYGRNINEKQISQVLKGLLDSKRNLNLVSS    701 - 770
TASIKDLADVDLRIVMCLMCGDPFSADDILFPVLQSQTCKSSHCGSNNSVLLELPIGLHKKRIELSVLSY    771 - 840
HSSFSIRKSRLVHGYIVFYSAKRKASLAMLRAFLCEVQDIIPIQLVALTDGAVDVLDNDLSREQLTEGEE    841 - 910
IAQEIDGRFTSIPCSQPQHKLEIFHPFFKDVVEKKNIIEATHMYDNAAEACSTTEEVFNSPRAGSPLCNS    911 - 980
NLQDSEEDIEPSYSLFREDTSLPSLSKDHSKLSMELEGNDGLSFIMSNFESKLNNKVPPPVKPKPPVHFE    981 - 1050
ITKGDLSYLDQGHRDGQRKSVSSSPWLPQDGFDPSDYAEPMDAVVKPRNEEENIYSVPHDSTQGKIITIR   1051 - 1120
NINKAQSNGSGNGSDSEMDTSSLERGRKVSIVSKPVLYRTRCTRLGRFASYRTSFSVGSDDELGPIRKKE   1121 - 1190
EDQASQGYKGDNAVIPYETDEDPRRRNILRSLRRNTKKPKPKPRPSITKATWESNYFGVPLTTVVTPEKP   1191 - 1260
IPIFIERCIEYIEATGLSTEGIYRVSGNKSEMESLQRQFDQDHNLDLAEKDFTVNTVAGAMKSFFSELPD   1261 - 1330
PLVPYNMQIDLVEAHKINDREQKLHALKEVLKKFPKENHEVFKYVISHLNKVSHNNKVNLMTSENLSICF   1331 - 1400
WPTLMRPDFSTMDALTATRTYQTIIELFIQQCPFFFYNRPITEPPGARPSSPSAVASTVPFLTSTPVTSQ   1401 - 1470
PSPPQSPPPTPQSPMQPLLPSQLQAEHTL                                            1471 - 1499
//

Text Mined References (53)

PMID Year Title
25359885 2015 A complex of p190RhoGAP-A and anillin modulates RhoA-GTP and the cytokinetic furrow in human cells.
25185653 2014 Glucocorticoid receptor DNA binding factor 1 expression and osteosarcoma prognosis.
25136583 2014 Rho GTPase-activating protein 35 rs1052667 polymorphism and osteosarcoma risk and prognosis.
25025568 2014 A Blk-p190RhoGAP signaling module downstream of activated G?13 functionally opposes CXCL12-stimulated RhoA activation and cell invasion.
24465899 2014 p120RasGAP is a mediator of rho pathway activation and tumorigenicity in the DLD1 colorectal cancer cell line.
24403595 2014 The human papillomavirus E7 proteins associate with p190RhoGAP and alter its function.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24043274 2013 p190A RhoGAP is involved in EGFR pathways and promotes proliferation, invasion and migration in lung adenocarcinoma cells.
23552690 2013 RhoA is down-regulated at cell-cell contacts via p190RhoGAP-B in response to tensional homeostasis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...