Property Summary

NCBI Gene PubMed Count 10
Grant Count 9
Funding $546,317.69
PubMed Score 7.96
PubTator Score 5.32

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
astrocytic glioma -1.300 0.030
osteosarcoma -1.323 0.000
atypical teratoid / rhabdoid tumor -1.100 0.001
medulloblastoma, large-cell -1.200 0.000
tuberculosis and treatment for 6 months -1.200 0.000

Gene RIF (3)

PMID Text
19786574 MISE is part of the INTS3/MISE/hSSB1 (IMS1) complex, which controls the DNA damage response
19683501 SOSS-C is part of an ssDNA-binding heterotrimeric complex, SOSS which is involved in the maintenance of genome stability.
19605351 hSSBIP1 forms complexes with INTS3/hSSB1 and INTS3/hSSB2 and participates in the DNA damage response

AA Sequence

MAANSSGQGFQNKNRVAILAELDKEKRKLLMQNQSSTNHPGASIALSRPSLNKDFRDHAEQQHIAAQQKA      1 - 70
ALQHAHAHSSGYFITQDSAFGNLILPVLPRLDPE                                         71 - 104
//

Text Mined References (12)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
19786574 2009 INTS3 controls the hSSB1-mediated DNA damage response.
19683501 2009 SOSS complexes participate in the maintenance of genomic stability.
19605351 2009 HSSB1 and hSSB2 form similar multiprotein complexes that participate in DNA damage response.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18449195 2008 Single-stranded DNA-binding protein hSSB1 is critical for genomic stability.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15164053 2004 DNA sequence and analysis of human chromosome 9.
More...