Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (5)

Disease log2 FC p
Breast cancer 2.400 3.8e-02
medulloblastoma, large-cell -1.100 1.0e-03
ovarian cancer -1.300 4.5e-07
pancreatic cancer 1.300 1.8e-03
pancreatic ductal adenocarcinoma liver m... -1.292 3.9e-02

Synonym

Accession Q9NRX6 B2RUU9
Symbols AD-020
C1orf119

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

AA Sequence

MTNVYSLDGILVFGLLFVCTCAYFKKVPRLKTWLLSEKKGVWGVFYKAAVIGTRLHAAVAIACVVMAFYV      1 - 70
LFIK                                                                       71 - 74
//

Text Mined References (8)

PMID Year Title