Property Summary

NCBI Gene PubMed Count 12
PubMed Score 29.56
PubTator Score 42.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung adenocarcinoma 2714 2.48996047066805E-11
ovarian cancer 8492 6.28357218698542E-10
medulloblastoma, large-cell 6234 1.58705153467809E-5
osteosarcoma 7933 3.12316533038717E-5
atypical teratoid / rhabdoid tumor 4369 5.30545384106601E-5
Multiple myeloma 1328 3.90384677605161E-4
invasive ductal carcinoma 2950 5.37343294561513E-4

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.227 0.000
osteosarcoma 1.618 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.700 0.000
lung adenocarcinoma -1.300 0.000
invasive ductal carcinoma -1.100 0.001
ovarian cancer -3.000 0.000

Synonym

Accession Q9NRX5 B3KY69 E1P565 O75655 Q7Z2F5 Q8TAG1 Q9NTH8 Q9ULG7
Symbols TDE2
TMS2
TDE1L
TMS-2

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA Inparanoid
Pig OMA EggNOG
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (1)

PMID Text
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSVLGLCSMASWIPCLCGSAPCLLCRCCPSGNNSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPG      1 - 70
FCENEKGVVPCNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGA     71 - 140
FFIPEGTFTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSL    141 - 210
VAIVLFFVYYTHPASCSENKAFISVNMLLCVGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMT    211 - 280
NEPETNCNPSLLSIIGYNTTSTVPKEGQSVQWWHAQGIIGLILFLLCVFYSSIRTSNNSQVNKLTLTSDE    281 - 350
STLIEDGGARSDGSLEDGDDVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQW    351 - 420
TAVWVKISSSWIGIVLYVWTLVAPLVLTNRDFD                                         421 - 453
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...