Property Summary

NCBI Gene PubMed Count 12
Grant Count 8
R01 Count 8
Funding $2,540,649.99
PubMed Score 29.56
PubTator Score 42.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Multiple myeloma 2.227 0.000
osteosarcoma 1.618 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.700 0.000
lung adenocarcinoma -1.300 0.000
invasive ductal carcinoma -1.100 0.001
ovarian cancer -3.000 0.000

Gene RIF (1)

PMID Text
18978678 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MGSVLGLCSMASWIPCLCGSAPCLLCRCCPSGNNSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPG      1 - 70
FCENEKGVVPCNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGA     71 - 140
FFIPEGTFTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSL    141 - 210
VAIVLFFVYYTHPASCSENKAFISVNMLLCVGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMT    211 - 280
NEPETNCNPSLLSIIGYNTTSTVPKEGQSVQWWHAQGIIGLILFLLCVFYSSIRTSNNSQVNKLTLTSDE    281 - 350
STLIEDGGARSDGSLEDGDDVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQW    351 - 420
TAVWVKISSSWIGIVLYVWTLVAPLVLTNRDFD                                         421 - 453
//

Text Mined References (20)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20213681 2010 Strategy for comprehensive identification of human N-myristoylated proteins using an insect cell-free protein synthesis system.
20195357 2010 A comprehensive resource of interacting protein regions for refining human transcription factor networks.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...