Property Summary

NCBI Gene PubMed Count 12
PubMed Score 29.40
PubTator Score 42.50

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Spondylosis 16 3.046 1.5

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 5.3e-05
invasive ductal carcinoma -1.100 5.4e-04
lung adenocarcinoma -1.300 2.5e-11
medulloblastoma, large-cell -1.700 1.6e-05
Multiple myeloma 2.227 3.9e-04
osteosarcoma 1.618 3.1e-05
ovarian cancer -3.000 6.3e-10

Gene RIF (1)

AA Sequence

MGSVLGLCSMASWIPCLCGSAPCLLCRCCPSGNNSTVTRLIYALFLLVGVCVACVMLIPGMEEQLNKIPG      1 - 70
FCENEKGVVPCNILVGYKAVYRLCFGLAMFYLLLSLLMIKVKSSSDPRAAVHNGFWFFKFAAAIAIIIGA     71 - 140
FFIPEGTFTTVWFYVGMAGAFCFILIQLVLLIDFAHSWNESWVEKMEEGNSRCWYAALLSATALNYLLSL    141 - 210
VAIVLFFVYYTHPASCSENKAFISVNMLLCVGASVMSILPKIQESQPRSGLLQSSVITVYTMYLTWSAMT    211 - 280
NEPETNCNPSLLSIIGYNTTSTVPKEGQSVQWWHAQGIIGLILFLLCVFYSSIRTSNNSQVNKLTLTSDE    281 - 350
STLIEDGGARSDGSLEDGDDVHRAVDNERDGVTYSYSFFHFMLFLASLYIMMTLTNWYRYEPSREMKSQW    351 - 420
TAVWVKISSSWIGIVLYVWTLVAPLVLTNRDFD                                         421 - 453
//

Text Mined References (21)

PMID Year Title