Property Summary

NCBI Gene PubMed Count 36
Grant Count 16
R01 Count 14
Funding $3,925,669.1
PubMed Score 33.61
PubTator Score 20.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Bruxism 19 3.554 1.8

Expression

Gene RIF (14)

PMID Text
26537769 PHPT1 was expressed in the epithelium of proximal tubuli and nuclei of clear-cell renal cell carcinoma tissue samples.
25574816 PHPT1 can dephosphorylate phospholysine in chemically phosphorylated histone H1 and polylysine
25450458 The specific degradation of the PHPT1 splice variant indicates that the quality control and the self-guarding of the cellular system works at two levels, first at the RNA level and proteasome level.
24523290 the histidine phosphatase, protein histidine phosphatase 1, inhibits NDPK-B-activated TRPV5 in inside/out patch experiments.
21967643 Overexpression of PHP by the use of a plasmid vector, pIRES2-AcGFP1-PHP, induced apoptosis in HUVEC
21163124 Significantly higher expression levels of PHPT1 protein were found in lung cancer samples than in normal tissues adjacent to lung cancer.
20501872 these data implicate regulatory roles for PHPT1 in a G protein-sensitive step involved in nutrient-induced insulin secretion
19344975 These results demonstrate for the first time that PHP14 may be functionally important in lung cancer cell migration and the invasion of lung cancer cells, mediated partly through modulation of actin cytoskeleton rearrangement.
19138678 results suggest that an increased activity of protein histidine phosphatase (PHP) impairs neuron cellular function whereas downregulation of PHP does not
18991813 Solution structure and catalytic mechanism of human protein histidine phosphatase 1.
More...

AA Sequence

MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCD      1 - 70
CECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY                    71 - 125
//

Text Mined References (43)

PMID Year Title
26537769 2015 Nuclear expression and clinical significance of phosphohistidine phosphatase 1 in clear-cell renal cell carcinoma.
25574816 2015 Phosphohistidine phosphatase 1 (PHPT1) also dephosphorylates phospholysine of chemically phosphorylated histone H1 and polylysine.
25450458 2014 A splice variant of the human phosphohistidine phosphatase 1 (PHPT1) is degraded by the proteasome.
24523290 2014 Regulation of the epithelial Ca²? channel TRPV5 by reversible histidine phosphorylation mediated by NDPK-B and PHPT1.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21967643 2012 Influence of protein histidine phosphatase overexpression and down-regulation on human umbilical-vein endothelial cell viability.
21269460 2011 Initial characterization of the human central proteome.
21163124 2010 Clinical significance of PHPT1 protein expression in lung cancer.
More...