Property Summary

NCBI Gene PubMed Count 6
PubMed Score 6.22
PubTator Score 2.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
esophageal adenocarcinoma -2.600 0.018
psoriasis -1.800 0.000
glioblastoma multiforme 1.100 0.000
osteosarcoma 1.529 0.025
non-small cell lung cancer 1.243 0.000
Breast cancer 1.100 0.016

Synonym

Accession Q9NRX3 Q6IAH9
Symbols NUOMS

Gene

PANTHER Protein Class (1)

AA Sequence

MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKF      1 - 70
LAVSTDYKKLKKDRPDF                                                          71 - 87
//

Text Mined References (6)

PMID Year Title
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10931946 2000 Gene expression profiling in the human hypothalamus-pituitary-adrenal axis and full-length cDNA cloning.