Property Summary

Ligand Count 1
NCBI Gene PubMed Count 10
PubMed Score 7.84
PubTator Score 2.11

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Expression

  Differential Expression (6)

Disease log2 FC p
Breast cancer 1.100 1.6e-02
esophageal adenocarcinoma -2.600 1.8e-02
glioblastoma multiforme 1.100 1.8e-08
non-small cell lung cancer 1.243 7.2e-05
osteosarcoma 1.529 2.5e-02
psoriasis -1.800 2.9e-04

Synonym

Accession Q9NRX3 Q6IAH9
Symbols NUOMS

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

AA Sequence

MAGASLGARFYRQIKRHPGIIPMIGLICLGMGSAALYLLRLALRSPDVCWDRKNNPEPWNRLSPNDQYKF      1 - 70
LAVSTDYKKLKKDRPDF                                                          71 - 87
//

Text Mined References (10)

PMID Year Title