Property Summary

NCBI Gene PubMed Count 9
PubMed Score 6.04
PubTator Score 4.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
psoriasis -1.800 0.000
osteosarcoma 1.778 0.001
glioblastoma 1.500 0.000
medulloblastoma, large-cell 1.300 0.002
tuberculosis and treatment for 6 months 1.500 0.000
lung cancer 1.600 0.048
invasive ductal carcinoma 1.200 0.000

Synonym

Accession Q9NRX1 A8K6Q0 Q53G13 Q8WVB8
Symbols RRP20
KHRBP1

Gene

AA Sequence

MESEMETQSARAEEGFTQVTRKGGRRAKKRQAEQLSAAGEGGDAGRMDTEEARPAKRPVFPPLCGDGLLS      1 - 70
GKEETRKIPVPANRYTPLKENWMKIFTPIVEHLGLQIRFNLKSRNVEIRTCKETKDVSALTKAADFVKAF     71 - 140
ILGFQVEDALALIRLDDLFLESFEITDVKPLKGDHLSRAIGRIAGKGGKTKFTIENVTRTRIVLADVKVH    141 - 210
ILGSFQNIKMARTAICNLILGNPPSKVYGNIRAVASRSADRF                                211 - 252
//

Text Mined References (12)

PMID Year Title
24324551 2013 Genome wide association study (GWAS) of Chagas cardiomyopathy in Trypanosoma cruzi seropositive subjects.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16169070 2005 A human protein-protein interaction network: a resource for annotating the proteome.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15497447 2004 Cloning and characterization of a novel human RNA binding protein gene PNO1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...