Property Summary

NCBI Gene PubMed Count 24
Grant Count 6
R01 Count 4
Funding $649,592.67
PubMed Score 43.14
PubTator Score 29.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma 1.400 0.000
osteosarcoma -1.601 0.000
group 4 medulloblastoma -1.500 0.000
medulloblastoma, large-cell -1.700 0.000
tuberculosis 1.100 0.000
non-small cell lung cancer -1.142 0.000
ulcerative colitis 1.100 0.000
ovarian cancer 1.500 0.000
pituitary cancer -1.500 0.000
dermatomyositis 1.400 0.001

Synonym

Accession Q9NRW4 B4DK56 Q59GW2 Q5VWR2 Q96AR1
Symbols VHX
JKAP
JSP1
MKPX
JSP-1
MKP-x
LMWDSP2
LMW-DSP2

Gene

PDB

1WRM   4WOH  

Gene RIF (12)

PMID Text
26379151 Report morphologic features of ALK-negative anaplastic large cell lymphomas with DUSP22 gene rearrangements.
26223379 Studies suggest that the presence of dual specificity phosphatase 22 (DUSP22) and p63 tumor suppressor protein (TP63) rearrangements might be useful to support a diagnosis of anaplastic lymphoma kinase (ALK)-negative anaplastic large cell lymphoma (ALCL).
26032091 Reduced DUSP22 expression was found in colorectal cancer specimens. Low expression level of DUSP22 in stage IV patients had a poor survival outcome
25664796 The structure illuminates the molecular basis for substrate binding and may also facilitate the structure-assisted development of DUSP22 inhibitors.
25390351 findings suggest that CCR8 expression in ALCL is more closely related to the presence of DUSP22 rearrangements than to cutaneous involvement and that the function of CCR8 may extend beyond its skin-homing properties in this disease
24436131 study identified presence of promoter hypermethylation of the DUSP22 gene in Alzheimer's disease(AD); DUSP22 is a likely candidate gene for involvement in the pathogenesis of AD since it inhibits PKA activity and thereby determines TAU phosphorylation status and CREB signaling
23337887 Biallelic rearrangements of DUSP22 is found in CD30-positive T-cell lymphoproliferative disorders.
22796920 Firefighters had a higher prevalence of dual specificity phosphatase 22-promoter hypomethylation in blood DNA (P = 0.03) and the extent of hypomethylation correlated with duration of firefighting service (P = 0.04) but not with age.
21030553 Data show that t(6;7)(p25.3;q32.3) was associated with down-regulation of DUSP22 and up-regulation of MIR29 microRNAs on 7q32.3.
20018849 a new role for JKAP in the modulation of FAK phosphorylation and cell motility.
More...

AA Sequence

MGNGMNKILPGLYIGNFKDARDAEQLSKNKVTHILSVHDSARPMLEGVKYLCIPAADSPSQNLTRHFKES      1 - 70
IKFIHECRLRGESCLVHCLAGVSRSVTLVIAYIMTVTDFGWEDALHTVRAGRSCANPNVGFQRQLQEFEK     71 - 140
HEVHQYRQWLKEEYGESPLQDAEEAKNILAAPGILKFWAFLRRL                              141 - 184
//

Text Mined References (26)

PMID Year Title
26379151 2016 Morphologic Features of ALK-negative Anaplastic Large Cell Lymphomas With DUSP22 Rearrangements.
26223379 2015 Progress in the identification of subgroups in ALK-negative anaplastic large-cell lymphoma.
26032091 2015 Decreased expression of dual specificity phosphatase 22 in colorectal cancer and its potential prognostic relevance for stage IV CRC patients.
25664796 2015 Structural analysis of human dual-specificity phosphatase 22 complexed with a phosphotyrosine-like substrate.
25390351 2015 Expression of the chemokine receptor gene, CCR8, is associated With DUSP22 rearrangements in anaplastic large cell lymphoma.
24436131 2014 Promoter hypermethylation of the phosphatase DUSP22 mediates PKA-dependent TAU phosphorylation and CREB activation in Alzheimer's disease.
23337887 2013 Primary cutaneous CD30-positive T-cell lymphoproliferative disorders with biallelic rearrangements of DUSP22.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22796920 2012 Hypomethylation of dual specificity phosphatase 22 promoter correlates with duration of service in firefighters and is inducible by low-dose benzo[a]pyrene.
21030553 2011 Discovery of recurrent t(6;7)(p25.3;q32.3) translocations in ALK-negative anaplastic large cell lymphomas by massively parallel genomic sequencing.
More...