Property Summary

NCBI Gene PubMed Count 60
PubMed Score 47.34
PubTator Score 17.34

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (3)

Disease log2 FC p
acute myeloid leukemia 1.400 3.0e-02
lung carcinoma -1.500 1.3e-26
subependymal giant cell astrocytoma 1.121 1.7e-02

Gene RIF (74)

AA Sequence

MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC      1 - 70
FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ     71 - 140
EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ                        141 - 190
//

Text Mined References (67)

PMID Year Title