Property Summary

NCBI Gene PubMed Count 57
Grant Count 17
R01 Count 3
Funding $840,978.47
PubMed Score 43.70
PubTator Score 17.34

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
subependymal giant cell astrocytoma 1.121 0.017
lung carcinoma -1.500 0.000
acute myeloid leukemia 1.400 0.030

Gene RIF (87)

PMID Text
26682542 These results suggest that functional potential of APOBEC3B and APOBEC3C involved in cancer mutagenesis is associated with estrogen receptor status.
25724652 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25650088 High APOBEC3C is associated with the pathogenesis of primary effusion lymphoma.
25576866 Expression of APOBEC3A or 3C in 293FT cells reduced the infectivity of HPV16 pseudovirions. The reduced infectivity of virions assembled in the presence of APOBEC3A, but not 3C, was attributed to decreased copy number of the encapsidated reporter plasmid.
25461536 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25461536 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25408426 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25352838 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25170834 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
25124760 APOBEC3C levels in virus particles are increased when the virus particles are produced from N.41 treated 293T cells in the presence of Vif expression
More...

AA Sequence

MNPQIRNPMKAMYPGTFYFQFKNLWEANDRNETWLCFTVEGIKRRSVVSWKTGVFRNQVDSETHCHAERC      1 - 70
FLSWFCDDILSPNTKYQVTWYTSWSPCPDCAGEVAEFLARHSNVNLTIFTARLYYFQYPCYQEGLRSLSQ     71 - 140
EGVAVEIMDYEDFKYCWENFVYNDNEPFKPWKGLKTNFRLLKRRLRESLQ                        141 - 190
//

Text Mined References (64)

PMID Year Title
27643540 2016 Association of germline variants in the APOBEC3 region with cancer risk and enrichment with APOBEC-signature mutations in tumors.
26682542 2015 Integrative genomic analysis reveals functional diversification of APOBEC gene family in breast cancer.
25650088 2015 Analysis of mutational signatures in exomes from B-cell lymphoma cell lines suggest APOBEC3 family members to be involved in the pathogenesis of primary effusion lymphoma.
25576866 2015 APOBEC3A and 3C decrease human papillomavirus 16 pseudovirion infectivity.
25416956 2014 A proteome-scale map of the human interactome network.
24709693 2014 Genome-wide data reveal novel genes for methotrexate response in a large cohort of juvenile idiopathic arthritis cases.
24227842 2014 APOBEC3 deaminases induce hypermutation in human papillomavirus 16 DNA upon beta interferon stimulation.
24101588 2014 Human LINE-1 restriction by APOBEC3C is deaminase independent and mediated by an ORF1p interaction that affects LINE reverse transcriptase activity.
23715497 2013 APOBEC3 deletion polymorphism is associated with breast cancer risk among women of European ancestry.
23001005 2012 The APOBEC3C crystal structure and the interface for HIV-1 Vif binding.
More...