Property Summary

NCBI Gene PubMed Count 15
PubMed Score 107.29
PubTator Score 252.19

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Multiple myeloma 1.752 0.001
malignant mesothelioma -1.800 0.000
oligodendroglioma -2.000 0.032
osteosarcoma -1.593 0.002
tuberculosis 1.500 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.001
intraductal papillary-mucinous carcinoma... -2.800 0.000
intraductal papillary-mucinous neoplasm ... -1.500 0.010
lung cancer -1.300 0.000
lung adenocarcinoma -1.300 0.000
lung carcinoma -1.300 0.000
ulcerative colitis -1.100 0.009
ovarian cancer -2.800 0.000

Gene RIF (8)

PMID Text
21709160 The functional activity of purified full-length HEBP1 has been evaluated on human formyl peptide receptor (FPR)3-expressing CHO-K1 cells
20800521 Results present a systematic molecular modeling study of the binding properties of murine and human p22HBP protein (heme-binding protein) with four tetrapyrrole ring systems belonging to the heme biosynthetic pathway.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
17237393 mouse neutrophils, which like macrophages and dendritic cells express Fpr2, responded to human and mouse F2L in both calcium flux and chemotaxis assays
15623572 F2L is a chemoattractant peptide promoting calcium mobilization and chemotaxis in dendritic cells and monocytes. [F2L]
12413491 Characterization as a tetrapyrrole-binding protein

AA Sequence

MLGMIKNSLFGSVETWPWQVLSKGDKEEVAYEERACEGGKFATVEVTDKPVDEALREAMPKVAKYAGGTN      1 - 70
DKGIGMGMTVPISFAVFPNEDGSLQKKLKVWFRIPNQFQSDPPAPSDKSVKIEEREGITVYSMQFGGYAK     71 - 140
EADYVAQATRLRAALEGTATYRGDIYFCTGYDPPMKPYGRRNEIWLLKT                         141 - 189
//

Text Mined References (19)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21709160 2011 Processing of HEBP1 by cathepsin D gives rise to F2L, the agonist of formyl peptide receptor 3.
21269460 2011 Initial characterization of the human central proteome.
20800521 2010 Tetrapyrrole binding affinity of the murine and human p22HBP heme-binding proteins.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
More...