Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.45
PubTator Score 3.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
adult high grade glioma -2.100 3.3e-06
astrocytic glioma -1.200 3.5e-03
Astrocytoma, Pilocytic -1.600 1.7e-06
atypical teratoid / rhabdoid tumor -2.100 3.5e-11
ependymoma -1.200 4.3e-03
glioblastoma -2.100 1.4e-10
group 3 medulloblastoma -2.600 3.6e-06
malignant mesothelioma 3.200 2.5e-08
oligodendroglioma -1.100 3.1e-13
primitive neuroectodermal tumor -2.200 2.9e-06

Gene RIF (2)

AA Sequence

MAAAAAAAAAVGVRLRDCCSRGAVLLLFFSLSPRPPAAAAWLLGLRPEDTAGGRVSLEGGTLRAAEGTSF      1 - 70
LLRVYFQPGPPATAAPVPSPTLNSGENGTGDWAPRLVFIEEPPGGGGVAPSAVPTRPPGPQRCREQSDWA     71 - 140
SDVEVLGPLRPGGVAGSALVQVRVRELRKGEAERGGAGGGGKLFSLCAWDGRAWHHHGAAGGFLLRVRPR    141 - 210
LYGPGGDLLPPAWLRALGALLLLALSALFSGLRLSLLSLDPVELRVLRNSGSAAEQEQARRVQAVRGRGT    211 - 280
HLLCTLLLGQAGANAALAGWLYTSLPPGFGGTGEDYSEEGIHFPWLPALVCTGAVFLGAEICPYSVCSRH    281 - 350
GLAIASHSVCLTRLLMAAAFPVCYPLGRLLDWALRQEISTFYTREKLLETLRAADPYSDLVKEELNIIQG    351 - 420
ALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILFVKDLAFVDPD    421 - 490
DCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQRVNNEGEGDPFYEVMGIVTLEDIIEEI    491 - 560
IKSEILDETDLYTDNRKKQRVPQRERKRHDFSLFKLSDTEMRVKISPQLLLATHRFMATEVEPFKSLYLS    561 - 630
EKILLRLLKHPNVIQELKFDEKNKKAPEHYLYQRNRPVDYFVLLLQGKVEVEVGKEGLRFENGAFTYYGV    631 - 700
PAIMTTACSDNDVRKVGSLAGSSVFLNRSPSRCSGLNRSESPNRERSDFGGSNTQLYSSSNNLYMPDYSV    701 - 770
HILSDVQFVKITRQQYQNALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSL    771 - 840
PCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLTLSPAAVPTRAASDSECCNINLDTETSPCS    841 - 910
SDFEENVGKKLLRTLSGQKRKRSPEGERTSEDNSNLTPLIT                                 911 - 951
//

Text Mined References (14)

PMID Year Title