Property Summary

NCBI Gene PubMed Count 40
PubMed Score 55.14
PubTator Score 39.00

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (30)

AA Sequence

MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHF      1 - 70
IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETAC     71 - 140
RQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEE    141 - 210
ASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIE    211 - 280
FNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQV    281 - 350
IDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYT    351 - 420
KVSAYLNWIYNVWKAEL                                                         421 - 437
//

Text Mined References (41)

PMID Year Title