Property Summary

NCBI Gene PubMed Count 37
Grant Count 7
Funding $2,028,127
PubMed Score 44.76
PubTator Score 39.00

Knowledge Summary

Patent

No data available

Expression

Gene RIF (27)

PMID Text
26722035 TMPRSS4 expression is associated with postoperative recurrence. In addition, the current survival curves demonstrated that TMPRSS4 expression is associated with statistically significant differences in survival among patients with lung adenocarcinoma.
26546046 suggesting that TMPRSS4 is associated with a cancer stem cells phenotype in patients' tumors
26190376 The increase of TMPRSS4 expression may be a key event for HCC progression and may be regarded as a potential prognostic marker for HCC.
25550850 In prostate cancer, high TMPRSS4 expression was significantly associated with advanced tumor stage and lymphatic metastasis.
25414083 TMPRSS4 is upregulated by silencing of TFPI-2 through aberrant DNA methylation and contributes to oncogenesis in non-small cell lung cancer.
25244400 TMPRSS4 is overexpressed in thyroid cancer and TMPRSS4-CREB signaling is needed to sustain thyroid cancer cell proliferation.
25203520 On the basis of this information and the structural characteristics of this druggable protease, we suggest that TMPRSS4 could be a novel potential therapeutic target in solid tumours.
24532432 increased TMPRSS4 expression was an independent predictor of poor prognosis for overall survival in gallbladder cancer. patients.
24434435 We have demonstrated for the first time a new molecular pathway that connects TMPRSS4 and integrin alpha5 through miR-205 to regulate cancer cell invasion and metastasis
24434139 TMPRSS4 directly converted inactive pro-uPA into the active form through its proteolytic activity. Conditioned medium from cells overexpressing TMPRSS4 showed that the active TMPRSS4 protease domain is released and is associated with the plasma membrane.
More...

AA Sequence

MLQDPDSDQPLNSLDVKPLRKPRIPMETFRKVGIPIIIALLSLASIIIVVVLIKVILDKYYFLCGQPLHF      1 - 70
IPRKQLCDGELDCPLGEDEEHCVKSFPEGPAVAVRLSKDRSTLQVLDSATGNWFSACFDNFTEALAETAC     71 - 140
RQMGYSSKPTFRAVEIGPDQDLDVVEITENSQELRMRNSSGPCLSGSLVSLHCLACGKSLKTPRVVGVEE    141 - 210
ASVDSWPWQVSIQYDKQHVCGGSILDPHWVLTAAHCFRKHTDVFNWKVRAGSDKLGSFPSLAVAKIIIIE    211 - 280
FNPMYPKDNDIALMKLQFPLTFSGTVRPICLPFFDEELTPATPLWIIGWGFTKQNGGKMSDILLQASVQV    281 - 350
IDSTRCNADDAYQGEVTEKMMCAGIPEGGVDTCQGDSGGPLMYQSDQWHVVGIVSWGYGCGGPSTPGVYT    351 - 420
KVSAYLNWIYNVWKAEL                                                         421 - 437
//

Text Mined References (38)

PMID Year Title
26722035 2016 TMPRSS4 Expression as a Marker of Recurrence in Patients with Lung Cancer.
26546046 2016 TMPRSS4 induces cancer stem cell-like properties in lung cancer cells and correlates with ALDH expression in NSCLC patients.
26190376 2015 TMPRSS4 facilitates epithelial-mesenchymal transition of hepatocellular carcinoma and is a predictive marker for poor prognosis of patients after curative resection.
25550850 2014 Clinical significance of TMPRSS4 in prostate cancer.
25416956 2014 A proteome-scale map of the human interactome network.
25414083 2015 Methylation-induced downregulation of TFPI-2 causes TMPRSS4 overexpression and contributes to oncogenesis in a subset of non-small-cell lung carcinoma.
25244400 2015 Transmembrane protease serine 4 promotes thyroid cancer proliferation via CREB phosphorylation.
25203520 2015 TMPRSS4: an emerging potential therapeutic target in cancer.
24532432 2014 Clinical implication of TMPRSS4 expression in human gallbladder cancer.
24434435 2014 TMPRSS4 regulates levels of integrin ?5 in NSCLC through miR-205 activity to promote metastasis.
More...