Property Summary

NCBI Gene PubMed Count 14
Grant Count 10
R01 Count 5
Funding $460,759.4
PubMed Score 26.02
PubTator Score 14.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
Spinocerebellar ataxia type 1 16 3.558 1.8

Expression

 GO Function (1)

Gene RIF (6)

PMID Text
24256120 results suggested that CIP75 is essential for the interaction of Cx43 and the proteasome, but that alternate compensatory mechanisms exist to supplement the degradation normally facilitated by CIP75
23459205 Targeting of Ubqln1 to autophagosomes requires the Ubqln4 UBL domain and the Ubqln1 UBA domain.
20940304 although CIP75 can interact with ubiquitinated cellular proteins, its interaction with Cx43 and stimulation of Cx43 proteasomal degradation does not require the ubiquitination of Cx43.
20702650 Co-immunoprecipitation confirmed the binding of small hydrophobic (SH) protein of mumps virus and ubiquilin 4 and demonstrates that a truncated protein fragment corresponding to amino acids 136-270 of ubiquilin 4 was sufficient for interaction.
18187620 Knockdown of ubiquilin 4 (UBQLN4) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
18079109 A novel connexin43-interacting protein, CIP75, which belongs to the UbL-UBA protein family, regulates the turnover of connexin43

AA Sequence

MAEPSGAETRPPIRVTVKTPKDKEEIVICDRASVKEFKEEISRRFKAQQDQLVLIFAGKILKDGDTLNQH      1 - 70
GIKDGLTVHLVIKTPQKAQDPAAATASSPSTPDPASAPSTTPASPATPAQPSTSGSASSDAGSGSRRSSG     71 - 140
GGPSPGAGEGSPSATASILSGFGGILGLGSLGLGSANFMELQQQMQRQLMSNPEMLSQIMENPLVQDMMS    141 - 210
NPDLMRHMIMANPQMQQLMERNPEISHMLNNPELMRQTMELARNPAMMQEMMRNQDRALSNLESIPGGYN    211 - 280
ALRRMYTDIQEPMFSAAREQFGNNPFSSLAGNSDSSSSQPLRTENREPLPNPWSPSPPTSQAPGSGGEGT    281 - 350
GGSGTSQVHPTVSNPFGINAASLGSGMFNSPEMQALLQQISENPQLMQNVISAPYMRSMMQTLAQNPDFA    351 - 420
AQMMVNVPLFAGNPQLQEQLRLQLPVFLQQMQNPESLSILTNPRAMQALLQIQQGLQTLQTEAPGLVPSL    421 - 490
GSFGISRTPAPSAGSNAGSTPEAPTSSPATPATSSPTGASSAQQQLMQQMIQLLAGSGNSQVQTPEVRFQ    491 - 560
QQLEQLNSMGFINREANLQALIATGGDINAAIERLLGSQLS                                 561 - 601
//

Text Mined References (22)

PMID Year Title
24674348 2014 The ubiquilin gene family: evolutionary patterns and functional insights.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24256120 2014 CIP75 (connexin43-interacting protein of 75 kDa) mediates the endoplasmic reticulum dislocation of connexin43.
23459205 2013 Ubiquilin4 is an adaptor protein that recruits Ubiquilin1 to the autophagy machinery.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23128233 2012 Host-microbe interactions have shaped the genetic architecture of inflammatory bowel disease.
21269460 2011 Initial characterization of the human central proteome.
20940304 2010 Ubiquitin-independent proteasomal degradation of endoplasmic reticulum-localized connexin43 mediated by CIP75.
20702650 2010 Mumps virus small hydrophobic protein targets ataxin-1 ubiquitin-like interacting protein (ubiquilin 4).
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...