Property Summary

NCBI Gene PubMed Count 109
Grant Count 153
R01 Count 101
Funding $22,640,953.54
PubMed Score 289.56
PubTator Score 326.59

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Synonym

Accession Q9NRR4 E7EMP9 Q7Z5V2 Q86YH0 Q9NW73 Q9Y2V9 Q9Y4Y0
Symbols RN3
ETOHI2
RNASEN
RANSE3L
RNASE3L
HSA242976

Gene

PDB

5B16   2KHX  

Gene RIF (92)

PMID Text
26976605 An essential role of DROSHA in the canonical miRNA pathway
26921501 we found that both the structural features of shmiR hairpins and the nucleotide sequence at Drosha and Dicer processing sites contribute to cleavage site selection and cleavage precision.
26748718 Study reports the X-ray structure of DROSHA in complex with the C-terminal helix of DGCR8; DROSHA contains two DGCR8-binding sites, one on each RNase III domain (RIIID), which mediate the assembly of Microprocessor; overall structure of DROSHA is surprisingly similar to that of Dicer despite no sequence homology apart from the C-terminal part.
26694172 Gradual loss of cytoplasmic Drosha was accompanied by tumor progression in both gastric cancer tissues and cell lines, and was inversely associated with tumor volume (P = 0.002), tumor grade (P < 0.001), tumor stage (P = 0.018), and distant metastasis
26683315 DGCR8 and Drosha assemble into a heterotrimeric complex on RNA, comprising two DGCR8 molecules and one Drosha molecule.
26522361 Drosha expression was reduced gradually with the degrading histological differentiation of gastric adenocarcinoma, and the knock-down of Drosha expression could promote gastric adenocarcinoma cell invasion.
26227789 Results indicate the role of Drosha, Dicer and Ago2 proteins in the development of non-small cell lung carcinomas (NSCLC) and suggest that Dicer may be implicated in the progression of these tumors to advanced stages.
26156018 DICER1 and DROSHA copy number variation may be an important mechanism of upregulation/downregulation of miRNAs in lung cancer
26147304 Variations in DROSHA rs10719 of Korean patients are significantly associated with their risk of colorectal cancer.
26027739 Together with a 23-amino acid peptide from DGCR8, DROSHA constitutes a minimal functional core. DROSHA serves as a "ruler" by measuring 11 bp from the basal ssRNA-dsRNA junction. DGCR8 interacts with the stem and apical elements through its dsRNA-binding domains and RNA-binding heme domain, respectively, allowing efficient and accurate processing.
More...

AA Sequence

MMQGNTCHRMSFHPGRGCPRGRGGHGARPSAPSFRPQNLRLLHPQQPPVQYQYEPPSAPSTTFSNSPAPN      1 - 70
FLPPRPDFVPFPPPMPPSAQGPLPPCPIRPPFPNHQMRHPFPVPPCFPPMPPPMPCPNNPPVPGAPPGQG     71 - 140
TFPFMMPPPSMPHPPPPPVMPQQVNYQYPPGYSHHNFPPPSFNSFQNNPSSFLPSANNSSSPHFRHLPPY    141 - 210
PLPKAPSERRSPERLKHYDDHRHRDHSHGRGERHRSLDRRERGRSPDRRRQDSRYRSDYDRGRTPSRHRS    211 - 280
YERSRERERERHRHRDNRRSPSLERSYKKEYKRSGRSYGLSVVPEPAGCTPELPGEIIKNTDSWAPPLEI    281 - 350
VNHRSPSREKKRARWEEEKDRWSDNQSSGKDKNYTSIKEKEPEETMPDKNEEEEEELLKPVWIRCTHSEN    351 - 420
YYSSDPMDQVGDSTVVGTSRLRDLYDKFEEELGSRQEKAKAARPPWEPPKTKLDEDLESSSESECESDED    421 - 490
STCSSSSDSEVFDVIAEIKRKKAHPDRLHDELWYNDPGQMNDGPLCKCSAKARRTGIRHSIYPGEEAIKP    491 - 560
CRPMTNNAGRLFHYRITVSPPTNFLTDRPTVIEYDDHEYIFEGFSMFAHAPLTNIPLCKVIRFNIDYTIH    561 - 630
FIEEMMPENFCVKGLELFSLFLFRDILELYDWNLKGPLFEDSPPCCPRFHFMPRFVRFLPDGGKEVLSMH    631 - 700
QILLYLLRCSKALVPEEEIANMLQWEELEWQKYAEECKGMIVTNPGTKPSSVRIDQLDREQFNPDVITFP    701 - 770
IIVHFGIRPAQLSYAGDPQYQKLWKSYVKLRHLLANSPKVKQTDKQKLAQREEALQKIRQKNTMRREVTV    771 - 840
ELSSQGFWKTGIRSDVCQHAMMLPVLTHHIRYHQCLMHLDKLIGYTFQDRCLLQLAMTHPSHHLNFGMNP    841 - 910
DHARNSLSNCGIRQPKYGDRKVHHMHMRKKGINTLINIMSRLGQDDPTPSRINHNERLEFLGDAVVEFLT    911 - 980
SVHLYYLFPSLEEGGLATYRTAIVQNQHLAMLAKKLELDRFMLYAHGPDLCRESDLRHAMANCFEALIGA    981 - 1050
VYLEGSLEEAKQLFGRLLFNDPDLREVWLNYPLHPLQLQEPNTDRQLIETSPVLQKLTEFEEAIGVIFTH   1051 - 1120
VRLLARAFTLRTVGFNHLTLGHNQRMEFLGDSIMQLVATEYLFIHFPDHHEGHLTLLRSSLVNNRTQAKV   1121 - 1190
AEELGMQEYAITNDKTKRPVALRTKTLADLLESFIAALYIDKDLEYVHTFMNVCFFPRLKEFILNQDWND   1191 - 1260
PKSQLQQCCLTLRTEGKEPDIPLYKTLQTVGPSHARTYTVAVYFKGERIGCGKGPSIQQAEMGAAMDALE   1261 - 1330
KYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIKK                             1331 - 1374
//

Text Mined References (120)

PMID Year Title
26976605 2016 Re-evaluation of the roles of DROSHA, Export in 5, and DICER in microRNA biogenesis.
26921501 2016 siRNA release from pri-miRNA scaffolds is controlled by the sequence and structure of RNA.
26748718 2016 Structure of Human DROSHA.
26694172 2016 Cytoplasmic Drosha Is Aberrant in Precancerous Lesions of Gastric Carcinoma and Its Loss Predicts Worse Outcome for Gastric Cancer Patients.
26683315 2016 A heterotrimer model of the complete Microprocessor complex revealed by single-molecule subunit counting.
26522361 2015 [A negative correlation between Drosha expression and gastric adenocarcinoma malignancy and invasion].
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26227789 2015 Expression of the microRNA regulators Drosha, Dicer and Ago2 in non-small cell lung carcinomas.
26156018 2015 High copy number variation of cancer-related microRNA genes and frequent amplification of DICER1 and DROSHA in lung cancer.
26147304 2015 3'-UTR Polymorphisms in the MiRNA Machinery Genes DROSHA, DICER1, RAN, and XPO5 Are Associated with Colorectal Cancer Risk in a Korean Population.
More...