Property Summary

Ligand Count 2
NCBI Gene PubMed Count 6
PubMed Score 20.53
PubTator Score 254.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 6.6e-15
lung adenocarcinoma 2716 6.1e-06
breast carcinoma 1638 3.5e-02

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.600 3.5e-02
lung adenocarcinoma 1.100 6.1e-06
psoriasis -1.200 6.6e-15

Gene RIF (2)

AA Sequence

MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSP      1 - 70
QWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSR     71 - 140
ILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLC    141 - 210
ARGPGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYP    211 - 280
RLPLLAGLFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD                                 281 - 321
//

Text Mined References (7)

PMID Year Title