Property Summary

NCBI Gene PubMed Count 6
PubMed Score 19.47
PubTator Score 254.47

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 6.63205513387002E-15
lung adenocarcinoma 2714 6.11131301951176E-6
breast carcinoma 1614 0.0349518583298241

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.600 0.035
lung adenocarcinoma 1.100 0.000
psoriasis -1.200 0.000

Synonym

Accession Q9NRR2 Q96RZ8 Q9C015 Q9NRQ8 Q9UBB2
Symbols TMT
trpA
PRSS31

Gene

  Ortholog (3)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20126998 tryptase promotes breast cancer migration and invasion.
12194977 TMT is an exocytosed MC neutral protease that induces AHR in lungs primarily by activating an IL-13/IL-4Ralpha/STAT6-dependent pathway.

AA Sequence

MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSP      1 - 70
QWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSR     71 - 140
ILPVCLPEASDDFCPGIRCWVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLC    141 - 210
ARGPGDACQDDSGGPLVCQVNGAWVQAGTVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYP    211 - 280
RLPLLAGLFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD                                 281 - 321
//

Text Mined References (7)

PMID Year Title
20126998 2010 Mast cell tryptase promotes breast cancer migration and invasion.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
12217407 2002 New developments in the genetics and activation of mast cell proteases.
12194977 2002 Biochemical and functional characterization of human transmembrane tryptase (TMT)/tryptase gamma. TMT is an exocytosed mast cell protease that induces airway hyperresponsiveness in vivo via an interleukin-13/interleukin-4 receptor alpha/signal transducer and activator of transcription (STAT) 6-dependent pathway.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.
10843716 2000 Characterization of human gamma-tryptases, novel members of the chromosome 16p mast cell tryptase and prostasin gene families.
10521469 1999 Identification of a new member of the tryptase family of mouse and human mast cell proteases which possesses a novel COOH-terminal hydrophobic extension.