Property Summary

NCBI Gene PubMed Count 12
Grant Count 7
R01 Count 1
Funding $226,057.27
PubMed Score 56.03
PubTator Score 432.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Gene RIF (8)

PMID Text
26800213 role in regulation embryo implantation
26800213 Cytl1 is highly expressed in the endometrium during the embryo implantation and its expression is regulated by ovarian hormones. Cytl1 enhances endometrial proliferation, induces the secretion of endometrial LIF and HB-EGF, and even enhances endometrial cell adhesion to trophoblastic cells. These indicate that Cytl1 is a potential molecular mediator of embryo is a potential molecular mediator in embryo implantation.
22797702 our results showed the first evidence of CYTL1 expression in SH-SY5Y neuroblastoma cells and human NB tissues, revealed a possible link between CYTL1 and NB development
22613542 evidence suggests that ANKRD7 and CYTL1 genes may play an important role in the variance in alcohol drinking risk
22011669 The DNA methylation pattern of the CYTL1 promoter region was significantly different between early and advanced stages of squamous cell carcinoma.
21799806 C17 as a cytokine that s contributes to immune homeostasis systemically or in a tissue-specific manner in the joint
21503106 C17orf62-L could induce cell death accompanied with rising of cleaved PARP.
21322034 We report a structural-functional characterization of cytokine-like protein 1 (Cytl1) by a combination of different computational structure-based techniques.

AA Sequence

MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV      1 - 70
LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR         71 - 136
//

Text Mined References (12)

PMID Year Title
26800213 2016 Cytokine-Like Protein 1(Cytl1): A Potential Molecular Mediator in Embryo Implantation.
22797702 2012 Cytokine-like 1 is involved in the growth and metastasis of neuroblastoma cells.
22613542 2012 ANKRD7 and CYTL1 are novel risk genes for alcohol drinking behavior.
22011669 2012 Genome-wide analysis of DNA methylation and the gene expression change in lung cancer.
21799806 2011 C17 prevents inflammatory arthritis and associated joint destruction in mice.
21503106 2011 [Study on the mechanism of C17orf62 induced cell death].
21322034 2011 Identification of CCR2-binding features in Cytl1 by a CCL2-like chemokine model.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...