Property Summary

NCBI Gene PubMed Count 14
PubMed Score 59.15
PubTator Score 432.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.700 1.3e-03
Astrocytoma, Pilocytic 1.800 1.1e-04
glioblastoma 1.800 2.3e-06
mucosa-associated lymphoid tissue lympho... -1.145 1.8e-02
sonic hedgehog group medulloblastoma 1.100 2.1e-02

Gene RIF (10)

AA Sequence

MRTPGPLPVLLLLLAGAPAARPTPPTCYSRMRALSQEITRDFNLLQVSEPSEPCVRYLPRLYLDIHNYCV      1 - 70
LDKLRDFVASPPCWKVAQVDSLKDKARKLYTIMNSFCRRDLVFLLDDCNALEYPIPVTTVLPDRQR         71 - 136
//

Text Mined References (14)

PMID Year Title